0 JB[ X I=I=S!H=N GnCN`%cq   F@@@j5```E,"[(?Ƞ!H=!H=!H=AI= I= I=A0I=k!H=isF=     AI=j!H=<!psF=j!H=%< !psF=j!H="<!psF=j!H=#< Đ!psF=j!H="<ǐ!psF=j!H=#<ʐ!psF=j!H=#<0͐!psF=j!H=#<!А!psF=j!H=#<Ӑ!psF=j!H=#<֐!psF=j!H=#<1ِ!psF=j!H=#<"ܐ!psF=j!H=#<ߐ!psF=j!H=#<!psF=j!H=#<2!psF=j!H=#<#!psF=j!H=#<!psF=j!H=#<!psF=j!H=#<3!psF=j!H=#<$!psF=j!H=#<!psF=j!H=$<!psF=j!H=#<4!psF=j!H=$<%!psF=j!H=$<!psF=j!H=$<!psF=j!H=$<5 !psF=j!H=$<& !psF=j!H=$<!psF=j!H=$<!psF=j!H=$<6!psF=j!H=$<'!psF=j!H=$<!psF=j!H=$<!psF=j!H=$<7!!psF=j!H=$<($!psF=j!H=$<'!psF=j!H=%< *!psF=j!H=$<8-!psF=j!H=%<)0!psF=j!H=%<3!psF=j!H=%<96!psF=j!H=%<9!psF=j!H=%<*<!psF=j!H=%<:?!psF=j!H=%< B!psF=j!H=%<E!psF=j!H=%<+H!psF=j!H=%<;K!psF=j!H=%< N!psF=j!H=%<Q!psF=j!H=%<,T!psF=j!H=%<<W!psF=j!H=%< Z!psF=j!H=&<]!psF=j!H=&<-`!psF=j!H=&<=c!psF=j!H=&<f!psF=j!H=&<i!psF=j!H=&<.l!psF=j!H=&<>o!psF=j!H=&<r!psF=j!H=&<u!psF=j!H=&</x!psF=j!H=&<?{!psF=j!H=&<@~AI=0H=0H=)kl*AI=G=G= F=j!H=16=@F=j!H=:F=j!H=,;F=j!H=x&;F=j!H=XI<F=j!H=CR:F=j!H=zc5F=j!H=PS:F=j!H=Ȁ<VF=j!H=; F=j!H=O:!F=j!H=E;"#ƒ)H=j!H=H=$%˒F=j!H=~TQ<&'ВF=j!H=S<()*+Ւ~F=j!H=;,ڒF=j!H=e;-ߒ+F=j!H=o<./F=j!H=O:0fF=j!H=O:1F=j!H=#;2F=j!H=렽;3> F=j!H=S<4567 F=j!H=S<89:;F=j!H=;<=>?dF=j!H= :@ F=j!H=?6;ABZF=j!H=t8CD#F=j!H=<EFF=j!H=IN;G 2F=j!H=FG<HI%\H=j!H=`;JK*WH=j!H=Q6<L/8F=j!H=|4<MN4tٍF=j!H=w4<OP9["H=^"H=^"H=>" F=j!H=/<QRSTC F=j!H=;UVWHF=j!H=\<XMF=j!H=x;;YZ[\R F=j!H=u1<]^_W I= I= I= I=fghijklmnopqrKH=j!H=y!=`a6H=j!H=(<afF=j!H=<bkF=j!H=<c` I=j!H=g0d\ I=j!H=4̓;eF=j!H=<fF=j!H=<g` I=j!H=6hVF=j!H=a8i\ I=j!H=ˋ<jF=j!H=t<mnopqrstuvwxyG=j!H=>v<F=j!H=gk;F=j!H=;T&F=j!H=l<=F=j!H=<F=j!H=<H=j!H=&;AI=G=G=j!H=j!H=j!H=../init.d/makedevj!H=j!H=j!H=../init.d/rmnologinj!H=j!H=j!H=../init.d/cronj!H=j!H=j!H=../init.d/inetdj!H=j!H=j!H=../init.d/exim j!H=j!H=j!H=../init.d/atd j!H=j!H=j!H=../init.d/pppj!H=j!H=j!H=../init.d/klogdj!H=j!H=j!H=../init.d/sysklogd j!H=j!H=j!H=../init.d/ssh j!H=j!H=j!H=../init.d/zebraj!H=j!H=j!H=../init.d/bindj!H=j!H=j!H=../init.d/acpid F=j!H=[<_H=j!H=H=dDn I=j!H=H=i8` I=j!H=F=nu I=j!H=F= spF=j!H=F=x,F=j!H=<` I=j!H=j!H=/usr/share/zoneinfo/CETNٍF=j!H=gF=H=j!H=H=+F=j!H=cF=IF=j!H=<<^F=j!H=;` I=j!H=F=AI=j!H=F=ŗ|F=j!H=<˗F=j!H=U9<З[F=j!H=<՗AI=j!H=F=ٗAI=j!H=V<ޗF=j!H=<<AI=G=G=F=j!H=w4<F=j!H=S<AI=j!H=F=F=j!H=H=k!H=;"     uٍF=k!H=w4<zF=k!H=fUQ< H=k!H=H=` I=k!H=<` I=G=G=e F=k!H='< 4F=k!H=8=AI=k!H=F= WF=k!H=<!"#$%&'()*+,-čF=k!H=čF=xZF=k!H==yzPF=k!H=<{wF=k!H=<|F=k!H=<}F=k!H=<~_F=k!H=<ŘF=k!H=<ʘ` I=k!H=<ϘF=k!H=H=ޘPF=k!H=<F=k!H=F=tF=k!H= psF=k!H=;=/012345C)psF=k!H=;=6789:;<=>?@H0!psF=k!H=;=ABCDEFGHIMpsF=k!H=;=NJKLMNOPQRSTUVR`psF=k!H=;= qrstuvW0psF=k!H=;=wxyz\/psF=k!H=;={|}~aTpsF=k!H=;=fAI=k!H=;=yAI=k!H=;=~4epsF=k!H=;=6psF=k!H=;= psF=k!H=;=psF=k!H=;= psF=k!H=;= @psF=k!H=;=$$ psF=k!H=;=psF=k!H=;=]psF=k!H=;=2 psF=k!H=;= psF=k!H=;=4psF=k!H=;=psF=k!H=;=p psF=k!H=;=Ś psF=k!H=;=ʚpsF=k!H=;=ϚpsF=k!H=;=ԚpsF=k!H=;=ٚpsF=k!H=;=ޚpsF=k!H=;=$psF=k!H=;=     4psF=k!H=;=LpsF=k!H=;= \ psF=k!H=;=8 psF=k!H=;=psF=k!H=;= psF=k!H=;= !"#psF=k!H=;=$% t+psF=k!H=;=&'()*+,-./0psF=k!H=;= 123456psF=k!H=;= 789:;<psF=k!H=;==>?@P4psF=k!H=;=ABCDEFGHIJKLM$ psF=k!H=;=PQR)$psF=k!H=;=STUVWXYZ[\.,+psF=k!H=;=]^_`abcdefg3k!H=k!H=k!H=/usr/src/linuxA}psF=k!H=;=hijklmnJpsF=k!H=;=oOpsF=k!H=;=pqrstuvTQpsF=k!H=;=wYpsF=k!H=;=x^psF=k!H=;=ycIpsF=k!H=;=zhpsF=k!H=;={mF=k!H=Yi< |}~r$<F=k!H=Yi<"w6F=k!H=Yi<|\2F=k!H=Yi<"F=k!H=Yi<k!H=k!H=k!H=libcom_err.so.2.0 k!H=k!H=k!H=libss.so.2.0 k!H=k!H=k!H=libe2p.so.2.3k!H=k!H=k!H=libext2fs.so.2.4k!H=k!H=k!H=libuuid.so.1.2P-F=k!H=<k!H=k!H=k!H=libcap.so.1.10b`u I=k!H="6=      F=k!H="6=^_`a"F=k!H="6=bcdefghiju I=k!H="6=pqrstuvwxyz{|}Jn I=k!H="6=( F=k!H="6=d Hn I=k!H="6=# $ % & ' ( ) * (n I=k!H="6=+ , - . / 0 1 2 3 4 5 6 7 ś`` I=k!H="6= ʛ؜` I=k!H="6=R ϛ/` I=k!H="6=   ! " # $ % & ' ( ԛ` I=k!H="6=B) * + , - . / 0 1 2 3 4 5 ٛ3F=k!H="6=J K L M N O P Q R S T U V ޛF=k!H="6=FX Y Z [ \ ] ^ _ ` a b c d F=k!H="6=J{ | } ~  ` I=k!H="6=r \[g I=k!H="6=0 F=k!H="6= )F=k!H="6=    g I=k!H="6=         7F=k!H="6=i j k l m n o p q r s t u k!H=k!H=k!H=libdb1-2.2.5.so u I=k!H=k!H=ld-2.2.5.so u I=k!H=k!H=libc-2.2.5.sok!H=k!H=k!H=libBrokenLocale-2.2.5.so n I=k!H=k!H=libm-2.2.5.sok!H=k!H=k!H=libdb1-2.2.5.son I=k!H=k!H=libdl-2.2.5.son I=k!H=k!H=libcrypt-2.2.5.sog I=k!H=k!H=libpthread-0.9.so` I=k!H=k!H=libresolv-2.2.5.so` I=k!H=k!H=libnss_dns-2.2.5.sok!H=k!H=k!H=libanl-2.2.5.so` I=k!H=k!H=libnss_files-2.2.5.sog I=k!H=k!H=librt-2.2.5.soĜk!H=k!H=k!H=libthread_db-1.0.soǜk!H=k!H=k!H=libnss_hesiod-2.2.5.soʜ` I=k!H=k!H=libnsl-2.2.5.so͜k!H=k!H=k!H=libnss_nis-2.2.5.soМk!H=k!H=k!H=libutil-2.2.5.soӜk!H=k!H=k!H=libnss_nisplus-2.2.5.so֜` I=k!H=k!H=libnss_compat-2.2.5.soٜF=k!H=<x y z { | } ~  ݜF=k!H=<z { | } ~  k!H=k!H=k!H=libdb2.so.2.7.7Dn I=k!H=¤<`abcdefghijkln I=k!H=k!H=libncurses.so.5.2rF=k!H=1yL<<TUVWXYZ[\]^_`LF=k!H=1yL<rstuvwxyH&F=k!H=1yL<z{|}~k!H=k!H=k!H=libpam.so.0.72k!H=k!H=k!H=libpam_misc.so.0.72k!H=k!H=k!H=libpamc.so.0.72PG=k!H=v|<, G=k!H=k!H=libpopt.so.0.0.0 PF=k!H=2`<,;G=k!H=2`< k!H=k!H=k!H=libhistory.so.4.2G=k!H=k!H=libreadline.so.4.2hH=k!H=&;H@ABCDEFGHIJKL"&G=k!H=x m<defghijklmnopq'G=k!H=k!H=libslang.so.1.4.4++F=k!H=;/pF=k!H=;x4AF=k!H=;$9k!H=k!H=k!H=libcfont.so.0.0.0=k!H=k!H=k!H=libconsole.so.0.0.0@k!H=k!H=k!H=libctutils.so.0.0.0C_F=k!H=5;2    Gk!H=k!H=k!H=libwrap.so.0.7.6KAI=l!H=H=#*AI=k!H=Ř8=$/LpsF=k!H=^<%&'()*+,-./015LpsF=k!H=^<z{|}~:!psF=k!H=^<?" psF=k!H=^<D3psF=k!H=^<IpsF=k!H=^<NAI=k!H=c<Ad I=k!H=o8=Ad I=k!H=z8=Ad I=d I=d I=k!H=k!H=k!H=/etc/alternatives/ipfwadm.8.gzk!H=k!H=k!H=../man7/undocumented.7.gzk!H=k!H=k!H=../man7/pam.7.gz k!H=k!H=k!H=vipw.8.gz k!H=k!H=k!H=pwconv.8.gz k!H=k!H=k!H=pwconv.8.gz k!H=k!H=k!H=pwconv.8.gz k!H=k!H=k!H=hwclock.8.gz¦ k!H=k!H=k!H=adduser.8.gzŦ k!H=k!H=k!H=deluser.8.gzȦ k!H=k!H=k!H=ifup.8.gz˦ k!H=k!H=k!H=lilo.8.gzΦk!H=k!H=k!H=../man7/undocumented.7.gzѦk!H=k!H=k!H=../man7/undocumented.7.gzԦk!H=k!H=k!H=../man7/undocumented.7.gzצk!H=k!H=k!H=tc-pbfifo.8.gzڦk!H=k!H=k!H=../man7/iproute.7.gzݦk!H=k!H=k!H=../man7/iproute.7.gzk!H=k!H=k!H=tc-pbfifo.8.gzk!H=k!H=k!H=../man7/iproute.7.gzk!H=k!H=k!H=../man7/iproute.7.gzk!H=k!H=k!H=../man7/iproute.7.gzAd I=I=I= k!H=k!H=k!H=bash.1.gzk!H=k!H=k!H=sensible-editor.1.gz k!H=k!H=k!H=grep.1.gz k!H=k!H=k!H=grep.1.gz k!H=k!H=k!H=grep.1.gz k!H=k!H=k!H=gzip.1.gz k!H=k!H=k!H=zdiff.1.gz k!H=k!H=k!H=gzip.1.gz k!H=k!H=k!H=gunzip.1.gz k!H=k!H=k!H=zgrep.1.gz k!H=k!H=k!H=zgrep.1.gz k!H=k!H=k!H=hostname.1.gz k!H=k!H=k!H=newgrp.1.gz k!H=k!H=k!H=tset.1.gz k!H=k!H=k!H=skill.1.gz k!H=k!H=k!H=pgrep.1.gz! k!H=k!H=k!H=test.1.gz$k!H=k!H=k!H=/etc/alternatives/awk.1.gz'k!H=k!H=k!H=/etc/alternatives/nawk.1.gz*k!H=k!H=k!H=/etc/alternatives/w.1.gz-k!H=k!H=k!H=../man7/undocumented.7.gz0k!H=k!H=k!H=nvi.1.gz3k!H=k!H=k!H=nvi.1.gz6k!H=k!H=k!H=/etc/alternatives/telnet.1.gz9k!H=k!H=k!H=/etc/alternatives/editor.1.gz<"k!H=k!H=k!H=/etc/alternatives/infobrowser.1.gz?k!H=k!H=k!H=/etc/alternatives/ex.1.gzBk!H=k!H=k!H=/etc/alternatives/vi.1.gzEk!H=k!H=k!H=/etc/alternatives/view.1.gzHk!H=k!H=k!H=ssh.1.gzKk!H=k!H=k!H=/etc/alternatives/rsh.1.gzNk!H=k!H=k!H=/etc/alternatives/rlogin.1.gzQk!H=k!H=k!H=/etc/alternatives/rcp.1.gzTk!H=k!H=k!H=/etc/alternatives/ncftp.1.gzWk!H=k!H=k!H=pon.1.gzZk!H=k!H=k!H=pon.1.gz]Ad I=k!H=<`Ad I=k!H=o8=eAd I=k!H=o8=jAd I=k!H= XQ<oAd I=k!H=o8=tAd I=k!H=o8=yAd I=k!H=98=~Ad I=k!H=o8=Ad I=k!H=o8=Ad I=k!H=<Ad I=k!H=o8=Ad I=k!H=o8=Ad I=I=I=k!H=k!H=k!H=../man7/pam.7.gz k!H=k!H=k!H=dialups.5.gz#k!H=k!H=k!H=/etc/alternatives/dhcp-options.5.gzAd I=k!H=sH=Ad I=k!H=o8=Ad I=k!H=o8=Ad I=k!H=<Ad I=k!H=o8=Ad I=k!H=o8=ç k!H=k!H=k!H=adduser.8.gzȧ k!H=k!H=k!H=deluser.8.gz˧Ad I=k!H=<ΧAd I=k!H=o8=ӧAd I=k!H=R<=اk!H=k!H=k!H=/etc/alternatives/ipfw.4.gzݧAI=0H=0H=gpsF=k!H=<6     AI=l!H==MpsF=l!H=@v<AI=l!H=<AI=l!H=<AI=l!H== fpsF=l!H=?v< psF=l!H=<AI=` I=` I=>psF=l!H=vk;%psF=l!H=/<*psF=l!H=/</AI=l!H=q8=3` I=l!H=)8=98psF=l!H=`8=>8psF=l!H=`8=C8psF=l!H=`8=H8psF=l!H=`8=M8psF=l!H=q8=RAI=l!H=S<VAI=l!H=8=[psF=l!H=2`<a]psF=l!H=S<f=psF=l!H=<k4psF=l!H=/<pAI=l!H=< tAI=l!H==yl!H=l!H=l!H=/etc/terminfo/a/ansi~AI=l!H==l!H=l!H=l!H=/etc/terminfo/d/dumbAI=l!H==G=l!H=l!H=/etc/terminfo/l/linuxAI=l!H==l!H=l!H=l!H=/etc/terminfo/m/machl!H=l!H=l!H=/etc/terminfo/m/mach-colorl!H=l!H=l!H=/etc/terminfo/m/mach-boldAI=l!H==l!H=l!H=l!H=/etc/terminfo/p/pcansiAI=l!H==l!H=l!H=l!H=/etc/terminfo/r/rxvtl!H=l!H=l!H=/etc/terminfo/r/rxvt-basicl!H=l!H=l!H=/etc/terminfo/r/rxvt-mAI=l!H==l!H=l!H=l!H=/etc/terminfo/s/sunl!H=l!H=l!H=/etc/terminfo/s/screen-wl!H=l!H=l!H=/etc/terminfo/s/screenl!H=l!H=l!H=/etc/terminfo/s/screen-bceêAI=l!H==ƪl!H=l!H=l!H=/etc/terminfo/v/vt52˪l!H=l!H=l!H=/etc/terminfo/v/vt100Ϊl!H=l!H=l!H=/etc/terminfo/v/vt102Ѫl!H=l!H=l!H=/etc/terminfo/v/vt220ԪAI=l!H==תl!H=l!H=l!H=/etc/terminfo/x/xterm-monoܪl!H=l!H=l!H=/etc/terminfo/x/xterm-debianߪl!H=l!H=l!H=/etc/terminfo/x/xterml!H=l!H=l!H=/etc/terminfo/x/xterm-colorl!H=l!H=l!H=/etc/terminfo/x/xterm-vt220l!H=l!H=l!H=/etc/terminfo/x/xterm-xfree86l!H=l!H=l!H=/etc/terminfo/x/xterm-r5l!H=l!H=l!H=/etc/terminfo/x/xterm-r6AI=l!H==psF=l!H=¤<psF=l!H=¤<@psF=l!H=¤<_psF=l!H=¤< AI=l!H=< AI=l!H=$8= G=l!H=O=<  G=l!H=O=<M%G=l!H=O=<,pG=l!H=O=<1AI=l!H=$8=?LG=l!H=O=<EAI=l!H=$8=IG=l!H=O=< O<G=l!H=O=<TAI=l!H=<gbpsF=l!H=O=<mQpsF=l!H=O=<r@G=l!H=O=<:G=l!H=O=<psF=l!H=O=<AI=l!H=<4/F=l!H==<    F=l!H==<   F=l!H==<7psF=l!H==<«psF=l!H==<ǫF=l!H==<̫G=l!H=O=<ѫ- psF=l!H=O=<֫G=l!H=O=<  !"#۫psF=l!H=O=<$RpsF=l!H=O=<%&psF=l!H=O=<'-psF=l!H=O=< ()*+,yG=l!H=O=<-'G=l!H=O=<./-G=l!H=O=<0123456789:;AI=l!H=<<fpsF=l!H=FN;=>lAI=l!H=8=?pAI=l!H=8=uJpsF=l!H=V<(@ABCDEFGHIJKL{; psF=l!H=V<TUVWpsF=l!H=V< XYZ[\? psF=l!H=V<]^_<psF=l!H=V<"`abcdefghijklpsF=l!H=V<dqrstuvwxyz{|}"psF=l!H=V< psF=l!H=V<@psF=l!H=V<j@>psF=l!H=V<"apsF=l!H=V<4QpsF=l!H=V<,/DpsF=l!H=V<&%&'()*+,-./01psF=l!H=V<89:;W)psF=l!H=V<<=>?@ABCDEF4psF=l!H=V< GHIJKƬSpsF=l!H=V<,LMNOPQRSTUVWXˬpsF=l!H=V< bcdefЬ?psF=l!H=V<bghijklmnopqrsլpsF=l!H=V<ڬp psF=l!H=V<߬ *psF=l!H=V<hpsF=l!H=V<80psF=l!H=V< YpsF=l!H=V<psF=l!H=V< _psF=l!H=V<L37psF=l!H=V<     -=psF=l!H=V<"PQRSTUVWXYZ[\psF=l!H=V<Dabcdefghijklm G psF=l!H=V<psF=l!H=V< tpsF=l!H=V<vpsF=l!H=V<> [psF=l!H=V<0%S9psF=l!H=V< *epsF=l!H=V</ psF=l!H=V<4nApsF=l!H=V<$9MpsF=l!H=V<*>psF=l!H=V<CpsF=l!H=V<NHpsF=l!H=V<MpsF=l!H=V<NRpsF=l!H=V<W psF=l!H=V<\ psF=l!H=V<:;<a7psF=l!H=V<=>?@ABCDEFGHIfAI=l!H=$8= }AI=l!H=<~AI=l!H=<OpsF=l!H=_=<*psF=l!H==< AI=l!H=<psF=l!H==< psF=l!H==<psF=l!H==< psF=l!H==<%fpsF=l!H=f=<*psF=l!H==</AI=l!H=<3'G=l!H=_=<9psF=l!H==<>AI=l!H=<BAI=l!H=<GpsF=l!H==<M3psF=l!H=_=<R\psF=l!H==<WAI=l!H=<[6G=l!H=_=<apsF=l!H==<fAI=l!H=$8=jpsF=l!H==<p<G=l!H=_=<uxG=l!H==<&'(zG=l!H==<)*+,-./AI=l!H=H=0hpsF=l!H=x&;1gpsF=l!H=?<2ipsF=l!H=Au:3psF=l!H=KЀ<4opsF=l!H=<5H=l!H=5<6AI=l!H=<7AI=l!H=Α8=8ZpsF=l!H=S<9EI=l!H=<2 :VEt I=l!H=~xF=2;`EI=l!H=<2<eEI=l!H=<2=jEI=l!H=<2>oEI=l!H=<2?tEI=l!H=<2@~AI=l!H=< AAI=G=G= BAI=` I=` I=CAI=l!H=F=D#F=l!H=F=EF=l!H=F=FkF=l!H=F=GF=l!H=F=H/psF=l!H=KC<=I*psF=l!H=@<=JpF=l!H=F=KF=l!H=F=LdF=l!H=F=MdF=l!H=F=NİnF=l!H=F=OɰpčF=l!H=<PΰgčF=l!H=<QӰsF=l!H=F=RذgčF=l!H=<SݰpsF=l!H=8=T'psF=l!H=@<=UA` I=` I=` I=VJAI=l!H=<WOAI=l!H=g<XTAI=l!H=g<YYAI=l!H=g<Z^m` I=` I=` I=x` I=` I=` I=` I=psF=` I=` I=n` I=l!H=<sk` I=` I=1H=]čF=l!H=<}` I=` I=~;cpsF=l!H=<psF=l!H=8=AI=l!H=c<AI=l!H=gk;AI=l!H= XQ<AI=l!H=<AI=l!H=V<AI=l!H=H=AI=l!H=8=An I=n I=n I=` I=d I=a9d I=p0H=0H=ރ<AI=l!H=F=WۻJF=l!H=<XY^F=l!H=F=Z[^F=l!H=F=\]AI=l!H=H=^AI=l!H=c<_EI=l!H=c<2`CI=l!H=c<aAI=G=G=bpsF=l!H=<+ 4spsF=l!H=8=+<cdefghijklmnoAI=l!H=<x psF=l!H=8=E I=l!H=ٍF= ٍF=l!H=ٍF= "ٍF=l!H=ٍF= 'ٍF=l!H=ٍF= ,XpsF=l!H=F=1JpsF=l!H=5F=6QpsF=l!H=2<;AI=l!H=O9<?ٍF=l!H=^F=EٍF=l!H=ٍF=JٍF=l!H=ٍF=OٍF=l!H=ٍF=TٍF=l!H=ٍF=YٍF=l!H=ٍF=^ٍF=l!H=ٍF=cٍF=l!H=ٍF=hٍF=l!H=ٍF=mٍF=l!H=ٍF=rٍF=l!H=F=wAI=l!H=H={psF=l!H=<+AI=l!H=<AI=l!H==F=l!H=F=F=l!H=F=AI=l!H=8=l!H=l!H=l!H=../mailAI=l!H=8=AI=l!H=<CI=l!H=8=CI=G=G=AI=l!H=<EI=l!H=<q` I=` I=` I=` I=i0H=` I=H=` I=$H=$H=!<?}G=G=<[k$H=$H=!<@W$H=$H=!<A$H=$H=!<BG=G=<G=G=k<q` I=` I=` I=` I=x` I=` I=` I=` I=r` I=` I=` I=` I=` I=` I=` I=` I= j` I=` I=` I=K G=I=f<I=\]^xG=I=f<I=_$H=$H=<C$H=$H=<DG=I=f<I=fG=I=f<I=g AI=I=I=I=h)z G=I=9:I=ijk1 G=I=|;I=lmno8AI=G=G=!G=I=8I=p? G=G=G=../init.d/ntpLG=G=G=! ;0H=1H=0H=1H=,0H=0H=ރ<G=I=DK7I=qF G=I=::I=rstMG=I=zh;I=nuvwxyz{|}~TG=I=<I= klmno[G=I=zh;I=n !"#$%&'()*+bG=I=<I=!!i#G=I=<I=!!!!!!!!!p H=I=C)C;I=`ab$cH=1H=G=1H=[\]^_`ab#H=I=C)C;I=c+H=H=H=../man7/undocumented.7.gz H=H=H=defrag.8.gz H=H=H=defrag.8.gz 0H=0H=G}<0H=0H=ރ<&0H=1H=0H=1H=,mW0H=I=ރ<I=0H=I=ރ<I=e0H=` I=H=` I=!!!!!!!!!!!!! 0H=I=ރ<I=0H=0H=ރ<EM0H=0H=G}<*BCDEFGHIJKLMN`:H=0H=ރ<o:H=0H=G}<d0H=1H=0H=1H=0H=1H=0H=1H=50H=1H=0H=1H= 20H=1H=0H=1H= !"#$%Kh` I=` I=1H=!!!!!!!!!!!""O . ..  lost+found bin boot devN etcflash home lib mnt proc rootI sbin tmp usr4var(filesimple_1%3a4.1.0-8_i386.deb ntp_1%3a4.1.0-8_i386.debntpdate_1%3a4.1.0-8_i386.debfile ... . .. lp10 lp0 ez0mouse0 lp1scanner0 ez1mouse1 lp2scanner1 ez2mouse2 lp3scanner2 ez3mouse3 lp4scanner3 ez4 mouse4! lp5"scanner4# ez5$mouse5% lp6&scanner5' ez6(mouse6) lp7*scanner6+ ez7,mouse7- lp8.scanner7/ ez80mouse81 lp92scanner83 ez94mouse95scanner96mouse107 ez108 scanner109 lp11:mouse11; ez11< scanner11= lp12>mouse12? ez12@ scanner12A lp13Bmouse13C ez13D scanner13E lp14Fmouse14G ez14H scanner14I lp15Jmouse15K ez15L scanner15MPrio500O .N ..P devpts.shQmakedevRmodutilsS procps.shT haltU rcVrebootWsingleXskeletonYREADMEZ rmnologin[urandom\ rcS] bootmisc.sh^ checkroot.sh_ checkfs.sh` mountall.sha mountnfs.shb hostname.shcsendsigsdumountfse umountnfs.shf hwclock.shghwclockfirst.shh networkingi cronjinetdknvibootl eximmifupdownn atdo pppp dns-cleanqklogdrsysklogds sshtiptablesuconsole-screen.shv keymap.shw setserialx(zebrantpdate.dpkg-newz bind{acpid ntpntpdate#! /bin/sh set -e . /etc/default/devpts [ "`uname -s`" = "Linux" ] || exit 0 # # First find out if devpts is available. Also check if devfs # is already mounted - in that case we don't want to use devpts. # devpts_avail=`grep -qci '[<[:space:]]devpts' /proc/filesystems || true` devpts_mounted=`grep -qci '/dev/pts' /proc/mounts || true` devfs_mounted=`grep -qci '[<[:space:]]/dev[>[:space:]].*devfs' /proc/mounts || true` if [ $devfs_mounted = 0 ] && [ $devpts_avail != 0 ] then # # Create mountpoint and multiplexor device. # [ -d /dev/pts ] || mkdir --mode=755 /dev/pts [ -c /dev/ptmx ] || mknod --mode=666 /dev/ptmx c 5 2 # # Mount /dev/pts if needed. # if [ $devpts_mounted = 0 ] then mount -t devpts devpts /dev/pts -ogid=${TTYGRP},mode=${TTYMODE} fi fi #! /bin/sh N=/etc/init.d/makedev PATH=/usr/local/sbin:/usr/local/bin:/sbin:/bin:/usr/sbin:/usr/bin set -e case "$1" in start) test -L /dev/MAKEDEV || ln -fs /sbin/MAKEDEV /dev/MAKEDEV ;; stop|reload|restart|force-reload) ;; *) echo "Usage: $N {start|stop|restart|force-reload}" >&2 exit 1 ;; esac exit 0 #! /bin/sh # /etc/init.d/modutils: loads the appropriate modules in `boot'. PATH="/sbin:/bin:/usr/sbin:/usr/bin" [ -f /proc/modules ] || exit 0 [ -e /sbin/depmod ] || exit 0 echo -n "Calculating module dependencies... " depmod -a > /dev/null echo "done." # Loop over every line in /etc/modules. echo -n 'Loading modules: ' (cat /etc/modules; echo) | # make sure there is a LF at the end while read module args do case "$module" in \#*|"") continue ;; esac echo -n "$module " modprobe $module $args done echo # # Just in case a sysadmin prefers generic symbolic links in # /lib/modules/boot for boot time modules we will load these modules # if [ -n "`modprobe -l -t boot`" ] then modprobe -a -t boot \* fi exit 0 #! /bin/sh # /etc/init.d/procps: Set kernel variables from /etc/sysctl.conf # # written by Elrond # Check for existance of the default file and exit if not there, # Closes #52839 for the boot-floppy people [ -r /etc/default/rcS ] || exit 0 . /etc/default/rcS [ -x /sbin/sysctl ] || exit 0 case "$1" in start|reload|restart|force-reload) if [ ! -r /etc/sysctl.conf ] then exit 0 fi if [ "$VERBOSE" = "no" ] then n="-n" redir=">/dev/null" else echo "Setting kernel variables." n="" redir="" fi eval "/sbin/sysctl $n -p $redir" ;; stop|show) ;; *) echo "Usage: /etc/init.d/procps.sh {start|stop|reload|restart}" >&2 exit 1 ;; esac #! /bin/sh # # halt Execute the halt command. # # Version: @(#)halt 2.84-2 07-Jan-2002 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin # See if we need to cut the power. if [ -x /etc/init.d/ups-monitor ] then /etc/init.d/ups-monitor poweroff fi # Don't shut down drives if we're using RAID. hddown="-h" if grep -qs '^md.*active' /proc/mdstat then hddown="" fi halt -d -f -i -p $hddown : exit 0 #! /bin/sh # # rc This file is responsible for starting/stopping # services when the runlevel changes. # # Optimization feature: # A startup script is _not_ run when the service was # running in the previous runlevel and it wasn't stopped # in the runlevel transition (most Debian services don't # have K?? links in rc{1,2,3,4,5} ) # # Author: Miquel van Smoorenburg # Bruce Perens # # Version: @(#)rc 2.78 07-Nov-1999 miquels@cistron.nl # # Un-comment the following for debugging. # debug=echo # # Start script or program. # startup() { case "$1" in *.sh) $debug sh "$@" ;; *) $debug "$@" ;; esac } # Ignore CTRL-C only in this shell, so we can interrupt subprocesses. trap ":" INT QUIT TSTP # Set onlcr to avoid staircase effect. stty onlcr 0>&1 # Now find out what the current and what the previous runlevel are. runlevel=$RUNLEVEL # Get first argument. Set new runlevel to this argument. [ "$1" != "" ] && runlevel=$1 if [ "$runlevel" = "" ] then echo "Usage: $0 " >&2 exit 1 fi previous=$PREVLEVEL [ "$previous" = "" ] && previous=N export runlevel previous # Is there an rc directory for this new runlevel? if [ -d /etc/rc$runlevel.d ] then # First, run the KILL scripts. if [ $previous != N ] then for i in /etc/rc$runlevel.d/K[0-9][0-9]* do # Check if the script is there. [ ! -f $i ] && continue # Stop the service. startup $i stop done fi # Now run the START scripts for this runlevel. for i in /etc/rc$runlevel.d/S* do [ ! -f $i ] && continue if [ $previous != N ] && [ $previous != S ] then # # Find start script in previous runlevel and # stop script in this runlevel. # suffix=${i#/etc/rc$runlevel.d/S[0-9][0-9]} stop=/etc/rc$runlevel.d/K[0-9][0-9]$suffix previous_start=/etc/rc$previous.d/S[0-9][0-9]$suffix # # If there is a start script in the previous level # and _no_ stop script in this level, we don't # have to re-start the service. # [ -f $previous_start ] && [ ! -f $stop ] && continue fi case "$runlevel" in 0|6) startup $i stop ;; *) startup $i start ;; esac done fi # eof /etc/init.d/rc #! /bin/sh # # reboot Execute the reboot command. # # Version: @(#)reboot 2.75 22-Jun-1998 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin echo -n "Rebooting... " reboot -d -f -i #! /bin/sh # # single executed by init(8) upon entering runlevel 1 (single). # # Version: @(#)single 1.20 26-Geb-2001 miquels@cistron.nl # PATH="/sbin:/bin:/usr/sbin:/usr/bin" # Kill all processes. echo -n "Sending all processes the TERM signal... " killall5 -15 echo "done." sleep 5 echo -n "Sending all processes the KILL signal... " killall5 -9 echo "done." # We start update here, since we just killed it. [ -x /sbin/update ] && update echo "Entering single-user mode..." exec init -t1 S #! /bin/sh # # skeleton example file to build /etc/init.d/ scripts. # This file should be used to construct scripts for /etc/init.d. # # Written by Miquel van Smoorenburg . # Modified for Debian GNU/Linux # by Ian Murdock . # # Version: @(#)skeleton 1.9.1 08-Apr-2002 miquels@cistron.nl # PATH=/usr/local/sbin:/usr/local/bin:/sbin:/bin:/usr/sbin:/usr/bin DAEMON=/usr/sbin/daemon NAME=daemon DESC="some daemon" test -x $DAEMON || exit 0 set -e case "$1" in start) echo -n "Starting $DESC: $NAME" start-stop-daemon --start --quiet --pidfile /var/run/$NAME.pid \ --exec $DAEMON echo "." ;; stop) echo -n "Stopping $DESC: $NAME " start-stop-daemon --stop --quiet --pidfile /var/run/$NAME.pid \ --exec $DAEMON echo "." ;; #reload) # # If the daemon can reload its config files on the fly # for example by sending it SIGHUP, do it here. # # If the daemon responds to changes in its config file # directly anyway, make this a do-nothing entry. # # echo -n "Reloading $DESC configuration..." # start-stop-daemon --stop --signal 1 --quiet --pidfile \ # /var/run/$NAME.pid --exec $DAEMON # echo "done." #;; restart|force-reload) # # If the "reload" option is implemented, move the "force-reload" # option to the "reload" entry above. If not, "force-reload" is # just the same as "restart". # echo -n "Restarting $DESC: $NAME" start-stop-daemon --stop --quiet --pidfile \ /var/run/$NAME.pid --exec $DAEMON sleep 1 start-stop-daemon --start --quiet --pidfile \ /var/run/$NAME.pid --exec $DAEMON echo "." ;; *) N=/etc/init.d/$NAME # echo "Usage: $N {start|stop|restart|reload|force-reload}" >&2 echo "Usage: $N {start|stop|restart|force-reload}" >&2 exit 1 ;; esac exit 0 Configuration of Init under Debian GNU/Linux Most Unix versions have a file here that describes how the scripts in this directory work, and how the links in the /etc/rc?.d/ directories influence system startup/shutdown. For Debian, this information is contained in the policy manual, chapter 10.3: system run levels. The home site for the Debian Policy Manual is at http://www.debian.org/doc/debian-policy/ The Debian Policy Manual is also available in the Debian package `debian-policy'. When this package is installed, the policy manual can be found in directory /usr/share/doc/debian-policy. If you have a web server and a browser installed you can probably read it at http://localhost/doc/debian-policy/ Make sure you have at least version 3.5.4.0 of the policy manual. Some more detailed info can also be found in /usr/share/doc/sysvinit. #! /bin/sh # # rmnologin This script removes the /etc/nologin file as the last # step in the boot process. # # Version: @(#)rmnologin 1.00 22-Jun-1998 miquels@cistron.nl # if [ -f /etc/nologin.boot ] then rm -f /etc/nologin /etc/nologin.boot fi : exit 0 #! /bin/sh # # urandom This script saves the random seed between reboots. # It is called from the boot, halt and reboot scripts. # # Version: @(#)urandom 1.33 22-Jun-1998 miquels@cistron.nl # [ -c /dev/urandom ] || exit 0 . /etc/default/rcS case "$1" in start|"") if [ "$VERBOSE" != no ] then echo -n "Initializing random number generator... " fi # Load and then save 512 bytes, # which is the size of the entropy pool if [ -f /var/lib/urandom/random-seed ] then cat /var/lib/urandom/random-seed >/dev/urandom fi rm -f /var/lib/urandom/random-seed umask 077 dd if=/dev/urandom of=/var/lib/urandom/random-seed count=1 \ >/dev/null 2>&1 || echo "urandom start: failed." umask 022 [ "$VERBOSE" != no ] && echo "done." ;; stop) # Carry a random seed from shut-down to start-up; # see documentation in linux/drivers/char/random.c [ "$VERBOSE" != no ] && echo -n "Saving random seed... " umask 077 dd if=/dev/urandom of=/var/lib/urandom/random-seed count=1 \ >/dev/null 2>&1 || echo "urandom stop: failed." [ "$VERBOSE" != no ] && echo "done." ;; *) echo "Usage: urandom {start|stop}" >&2 exit 1 ;; esac exit 0 #! /bin/sh # # rcS Call all S??* scripts in /etc/rcS.d in # numerical/alphabetical order. # # Version: @(#)/etc/init.d/rcS 2.76 19-Apr-1999 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin runlevel=S prevlevel=N umask 022 export PATH runlevel prevlevel mount -o remount,rw / mount /proc # skip configuration in case of default settings if ! grep -q defaults /proc/cmdline; then /bin/reconfigure else echo Not loading configuration, using default settings. fi # # Source defaults. # . /etc/default/rcS export VERBOSE # # Trap CTRL-C &c only in this shell so we can interrupt subprocesses. # trap ":" INT QUIT TSTP # # Call all parts in order. # for i in /etc/rcS.d/S??* do # Ignore dangling symlinks for now. [ ! -f "$i" ] && continue case "$i" in *.sh) # Source shell script for speed. ( trap - INT QUIT TSTP set start . $i ) ;; *) # No sh extension, so fork subprocess. $i start ;; esac done # # For compatibility, run the files in /etc/rc.boot too. # [ -d /etc/rc.boot ] && run-parts /etc/rc.boot # # bootmisc.sh Miscellaneous things to be done during bootup. # # Version: @(#)bootmisc.sh 2.83 02-Oct-2001 miquels@cistron.nl # . /etc/default/rcS # # Put a nologin file in /etc to prevent people from logging in before # system startup is complete. # if [ "$DELAYLOGIN" = yes ] then echo "System bootup in progress - please wait" > /etc/nologin cp /etc/nologin /etc/nologin.boot fi # # Wipe /tmp (and don't erase `lost+found', `quota.user' or `quota.group')! # Note that files _in_ lost+found _are_ deleted. # [ "$VERBOSE" != no ] && echo -n "Cleaning: /tmp " # # If $TMPTIME is set to 0, we do not use any ctime expression # at all, so we can also delete files with timestamps # in the future! # if [ "$TMPTIME" = 0 ] then TEXPR="" else TEXPR="! -ctime -$TMPTIME" fi ( cd /tmp && \ find . -xdev \ $TEXPR \ ! -name . \ ! \( -name lost+found -uid 0 \) \ ! \( -name quota.user -uid 0 \) \ ! \( -name quota.group -uid 0 \) \ ! \( -name .journal -uid 0 \) \ -depth -exec rm -rf -- {} \; ) rm -f /tmp/.X*-lock # # Clean up any stale locks. # [ "$VERBOSE" != no ] && echo -n "/var/lock " ( cd /var/lock && find . -type f ! -newer /etc/mtab -exec rm -f -- {} \; ) # # Clean up /var/run and create /var/run/utmp so that we can login. # [ "$VERBOSE" != no ] && echo -n "/var/run" ( cd /var/run && \ find . ! -type d ! -name utmp ! -name innd.pid \ ! -newer /etc/mtab -exec rm -f -- {} \; ) : > /var/run/utmp if grep -q ^utmp: /etc/group then chmod 664 /var/run/utmp chgrp utmp /var/run/utmp fi [ "$VERBOSE" != no ] && echo "." # # Set pseudo-terminal access permissions. # if [ ! -c /dev/.devfsd ] && [ -c /dev/ttyp0 ] then chmod 666 /dev/tty[p-za-e][0-9a-f] chown root:tty /dev/tty[p-za-e][0-9a-f] fi # # Update /etc/motd. # if [ "$EDITMOTD" != no ] then uname -a > /etc/motd.tmp sed 1d /etc/motd >> /etc/motd.tmp mv /etc/motd.tmp /etc/motd fi # # Save kernel messages in /var/log/dmesg # dmesg -s 65536 > /var/log/dmesg : exit 0 # # checkroot.sh Check to root file system. # # Version: @(#)checkroot.sh 2.84-3 25-Jan-2002 miquels@cistron.nl # . /etc/default/rcS # # Set SULOGIN in /etc/default/rcS to yes if you want a sulogin to be spawned # from this script *before anything else* with a timeout, like SCO does. # [ "$SULOGIN" = yes ] && sulogin -t 30 $CONSOLE # # Ensure that bdflush (update) is running before any major I/O is # performed (the following fsck is a good example of such activity :). # [ -x /sbin/update ] && update # # Read /etc/fstab. # exec 9>&0 &9 9>&- # # Mount /proc. If /proc/1 exists, but /proc is not mounted, # issue a warning so that the user knows something is wrong. # doproc=yes if [ -d /proc/1 ] then rootino=`ls -lid /proc | sed -ne 's/^ *\([0-9]\+\).*$/\1/p'` if [ "$rootino" -gt 2 ] then echo "WARNING: found junk under the /proc mountpoint" else doproc=no fi fi [ "$doproc" = yes ] && mount -n /proc # # Activate the swap device(s) in /etc/fstab. This needs to be done # before fsck, since fsck can be quite memory-hungry. # doswap=no case "`uname -r`" in 2.[0123].*) if [ $swap_on_md = yes ] && grep -qs resync /proc/mdstat then [ "$VERBOSE" != no ] && echo "Not activating swap - RAID array resyncing" else doswap=yes fi ;; *) doswap=yes ;; esac if [ $doswap = yes ] then [ "$VERBOSE" != no ] && echo "Activating swap." swapon -a 2> /dev/null fi # # Check the root file system. # if [ -f /fastboot ] || [ $rootcheck = no ] then [ $rootcheck = yes ] && echo "Fast boot, no file system check" else # # Ensure that root is quiescent and read-only before fsck'ing. # mount -n -o remount,ro / if [ $? = 0 ] then if [ -f /forcefsck ] then force="-f" else force="" fi if [ "$FSCKFIX" = yes ] then fix="-y" else fix="-a" fi spinner="-C" case "$TERM" in dumb|network|unknown|"") spinner="" ;; esac [ `uname -m` = s390 ] && spinner="" # This should go away echo "Checking root file system..." fsck $spinner $force $fix / # # If there was a failure, drop into single-user mode. # # NOTE: "failure" is defined as exiting with a return code of # 2 or larger. A return code of 1 indicates that file system # errors were corrected but that the boot may proceed. # if [ $? -gt 1 ] then # Surprise! Re-directing from a HERE document (as in # "cat << EOF") won't work, because the root is read-only. echo echo "fsck failed. Please repair manually and reboot. Please note" echo "that the root file system is currently mounted read-only. To" echo "remount it read-write:" echo echo " # mount -n -o remount,rw /" echo echo "CONTROL-D will exit from this shell and REBOOT the system." echo # Start a single user shell on the console /sbin/sulogin $CONSOLE reboot -f fi else echo "*** ERROR! Cannot fsck root fs because it is not mounted read-only!" echo fi fi # # If the root filesystem was not marked as read-only in /etc/fstab, # remount the rootfs rw but do not try to change mtab because it # is on a ro fs until the remount succeeded. Then clean up old mtabs # and finally write the new mtab. # mount -n -o remount,$rootmode / if [ "$rootmode" = rw ] then rm -f /etc/mtab~ /etc/nologin : > /etc/mtab mount -f -o remount / mount -f /proc [ "$devfs" ] && grep -q '^devfs /dev' /proc/mounts && mount -f "$devfs" fi : exit 0 # # checkfs.sh Check all filesystems. # # Version: @(#)checkfs 2.83 05-Oct-2001 miquels@cistron.nl # . /etc/default/rcS # # Check the rest of the file systems. # if [ ! -f /fastboot ] then if [ -f /forcefsck ] then force="-f" else force="" fi if [ "$FSCKFIX" = yes ] then fix="-y" else fix="-a" fi spinner="-C" case "$TERM" in dumb|network|unknown|"") spinner="" ;; esac [ `uname -m` = s390 ] && spinner="" # This should go away echo "Checking all file systems..." fsck $spinner -R -A $fix $force if [ $? -gt 1 ] then echo echo "fsck failed. Please repair manually." echo echo "CONTROL-D will exit from this shell and continue system startup." echo # Start a single user shell on the console /sbin/sulogin $CONSOLE fi fi rm -f /fastboot /forcefsck : exit 0 # # mountall.sh Mount all filesystems. # # Version: @(#)mountall.sh 2.83-2 01-Nov-2001 miquels@cistron.nl # . /etc/default/rcS # # Mount local file systems in /etc/fstab. For some reason, people # might want to mount "proc" several times, and mount -v complains # about this. So we mount "proc" filesystems without -v. # [ "$VERBOSE" != no ] && echo "Mounting local filesystems..." mount -avt nonfs,nosmbfs,noncpfs,noproc mount -at proc # # We might have mounted something over /dev, see if /dev/initctl is there. # if [ ! -p /dev/initctl ] then rm -f /dev/initctl mknod -m 600 /dev/initctl p fi kill -USR1 1 # # Execute swapon command again, in case we want to swap to # a file on a now mounted filesystem. # doswap=yes case "`uname -r`" in 2.[0123].*) if grep -qs resync /proc/mdstat then doswap=no fi ;; esac if [ $doswap = yes ] then swapon -a 2> /dev/null fi : exit 0 # # mountnfs.sh Now that TCP/IP is configured, mount the NFS file # systems in /etc/fstab if needed. If possible, # start the portmapper before mounting (this is needed for # Linux 2.1.x and up). # # Also mounts SMB filesystems now, so the name of # this script is getting increasingly inaccurate. # # Version: @(#)mountnfs.sh 2.84 08-Apr-2002 miquels@cistron.nl # . /etc/default/rcS # # Run in a subshell because of I/O redirection. # test -f /etc/fstab && ( # # Read through fstab line by line. If it is NFS, set the flag # for mounting NFS file systems. If any NFS partition is found and it # not mounted with the nolock option, we start the portmapper. # portmap=no mount_nfs=no mount_smb=no mount_ncp=no while read device mountpt fstype options do case "$device" in ""|\#*) continue ;; esac case "$options" in *noauto*) continue ;; esac if [ "$fstype" = nfs ] then mount_nfs=yes case "$options" in *nolock*) ;; *) portmap=yes ;; esac fi if [ "$fstype" = smbfs ] then mount_smb=yes fi if [ "$fstype" = ncpfs ] then mount_ncp=yes fi done exec 0>&1 if [ "$portmap" = yes ] then if [ -x /sbin/portmap ] then echo -n "Starting portmapper... " start-stop-daemon --start --quiet --exec /sbin/portmap sleep 2 fi fi if [ "$mount_nfs" = yes ] || [ "$mount_smb" = yes ] || [ "$mount_ncp" = yes ] then echo "Mounting remote filesystems..." [ "$mount_nfs" = yes ] && mount -a -t nfs [ "$mount_smb" = yes ] && mount -a -t smbfs [ "$mount_ncp" = yes ] && mount -a -t ncpfs fi ) < /etc/fstab : exit 0 # # hostname.sh Set hostname. # # Version: @(#)hostname.sh 1.10 26-Feb-2001 miquels@cistron.nl # if [ -f /etc/hostname ] then hostname --file /etc/hostname fi #! /bin/sh # # sendsigs Kill all remaining processes. # # Version: @(#)sendsigs 2.75 22-Jun-1998 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin # Kill all processes. echo -n "Sending all processes the TERM signal... " killall5 -15 echo "done." sleep 5 echo -n "Sending all processes the KILL signal... " killall5 -9 echo "done." : exit 0 #! /bin/sh # # umountfs Turn off swap and unmount all local file systems. # # Version: @(#)umountfs 2.83-3 31-Oct-2001 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin case "`uname -r`" in 1.*|2.[01].*) FORCE="" ;; *) FORCE="-f" ;; esac umount -ttmpfs $FORCE -a -r echo -n "Deactivating swap... " swapoff -a echo "done." # We leave /proc mounted. echo -n "Unmounting local filesystems... " umount -tnoproc $FORCE -a -r echo "done." mount -n -o remount,ro / : exit 0 #! /bin/sh # # umountnfs.sh Unmount all network file systems. # # Version: @(#)umountnfs.sh 2.78 05-Jun-2000 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin case "`uname -r`" in 1.*|2.[01].*) FORCE="" ;; *) FORCE="-f" ;; esac # Write a reboot record to /var/log/wtmp before unmounting halt -w echo -n "Unmounting remote filesystems... " umount -tnfs,smbfs,ncpfs $FORCE -a -r echo "done." : exit 0 #!/bin/sh # hwclock.sh Set and adjust the CMOS clock, according to the UTC # setting in /etc/default/rcS (see also rcS(5)). # # Version: @(#)hwclock.sh 2.00 14-Dec-1998 miquels@cistron.nl # # Patches: # 2000-01-30 Henrique M. Holschuh # - Minor cosmetic changes in an attempt to help new # users notice something IS changing their clocks # during startup/shutdown. # - Added comments to alert users of hwclock issues # and discourage tampering without proper doc reading. # WARNING: Please read /usr/share/doc/util-linux/README.Debian.hwclock # before changing this file. You risk serious clock # misbehaviour otherwise. . /etc/default/rcS [ "$GMT" = "-u" ] && UTC="yes" case "$UTC" in no|"") GMT="--localtime" ;; yes) GMT="--utc" ;; *) echo "$0: unknown UTC setting: \"$UTC\"" >&2 ;; esac case "$BADYEAR" in no|"") BADYEAR="" ;; yes) BADYEAR="--badyear" ;; *) echo "$0: unknown BADYEAR setting: \"$BADYEAR\"" >&2 ;; esac case "$1" in start) if [ ! -f /etc/adjtime ] then echo "0.0 0 0.0" > /etc/adjtime fi # Uncomment the hwclock --adjust line below if you want # hwclock to try to correct systematic drift errors in the # Hardware Clock. # # WARNING: If you uncomment this option, you must either make # sure *nothing* changes the Hardware Clock other than # hwclock --systohc, or you must delete /etc/adjtime # every time someone else modifies the Hardware Clock. # # Common "vilains" are: ntp, MS Windows, the BIOS Setup # program. # # WARNING: You must remember to invalidate (delete) # /etc/adjtime if you ever need to set the system clock # to a very different value and hwclock --adjust is being # used. # # Please read /usr/share/doc/util-linux/README.Debian.hwclock # before enablig hwclock --adjust. # # hwclock --adjust $GMT $BADYEAR if [ "$VERBOSE" != no ] then echo echo "Setting the System Clock using the Hardware Clock as reference..." fi # Copies Hardware Clock time to System Clock using the correct # timezone for hardware clocks in local time, and sets kernel # timezone. DO NOT REMOVE. if [ "$HWCLOCKACCESS" != no ] then hwclock --hctosys $GMT $BADYEAR fi # # Now that /usr/share/zoneinfo should be available, # announce the local time. # if [ "$VERBOSE" != no ] then echo "System Clock set. Local time: `date`" echo fi ;; stop|restart|reload|force-reload) # # Updates the Hardware Clock with the System Clock time. # This will *override* any changes made to the Hardware Clock. # # WARNING: If you disable this, any changes to the system # clock will not be carried across reboots. # if [ "$VERBOSE" != no ] then echo "Saving the System Clock time to the Hardware Clock..." fi [ "$GMT" = "-u" ] && GMT="--utc" if [ "$HWCLOCKACCESS" != no ] then hwclock --systohc $GMT $BADYEAR fi if [ "$VERBOSE" != no ] then echo "Hardware Clock updated to `date`." fi ;; show) if [ "$HWCLOCKACCESS" != no ] then hwclock --show $GMT $BADYEAR fi ;; *) echo "Usage: hwclock.sh {start|stop|reload|force-reload|show}" >&2 echo " start sets kernel (system) clock from hardware (RTC) clock" >&2 echo " stop and reload set hardware (RTC) clock from kernel (system) clock" >&2 exit 1 ;; esac #!/bin/bash # hwclockset.sh Set system clock to hardware clock, according to the UTC # setting in /etc/default/rcS (see also rcS(5)). # # # WARNING: Runs without write permission on /etc, and before # mounting all filesystems! If you need write permission # to do something, do it in hwclockadj.sh. # # WARNING: If your hardware clock is not in UTC/GMT, this script # must know the local time zone. This information is # stored in /etc/localtime. This might be a problem if # your /etc/localtime is a symlink to something in # /usr/share/zoneinfo AND /usr isn't in the root # partition! The workaround is to define TZ either # in /etc/default/rcS, or in the proper place below. # # REMEMBER TO EDIT hwclockadj.sh AS WELL! # Set this to any options you might need to give to hwclock, such # as machine hardware clock type for Alphas. HWCLOCKPARS= [ ! -x /sbin/hwclock ] && exit 0 . /etc/default/rcS # Define TZ to the desired timezone here if you need it. # see tzset(3) for how to define TZ. # WARNING: TZ takes precedence over /etc/localtime ! TZ= case "$UTC" in no|"") GMT="--localtime" UTC="" if [ ! -r /etc/localtime ] then if [ -z "$TZ" ] then echo "$0: System clock was not updated at this time." >&2 exit 1 fi fi ;; yes) GMT="--utc" UTC="--utc" ;; *) echo "$0: Unknown UTC setting: \"$UTC\"" >&2 exit 1 ;; esac case "$1" in start) if [ "$VERBOSE" != no ] then echo "System time was `date --utc`." echo "Setting the System Clock using the Hardware Clock as reference..." fi # Copies Hardware Clock time to System Clock using the correct # timezone for hardware clocks in local time, and sets kernel # timezone. DO NOT REMOVE. if [ -z "$TZ" ] then hwclock --noadjfile --hctosys $GMT $HWCLOCKPARS else TZ="$TZ" hwclock --noadjfile --hctosys $GMT $HWCLOCKPARS fi if hwclock --show $GMT $HWCLOCKPARS 2>&1 > /dev/null | grep -q '^The Hardware Clock registers contain values that are either invalid'; then echo "Invalid system date -- setting to 1/1/2002" hwclock --set --date '1/1/2002 00:00:00' $GMT $HWCLOCKPARS fi if [ "$VERBOSE" != no ] then echo "System Clock set. System local time is now `date $UTC`." fi ;; stop|restart|reload|force-reload) # Does nothing exit 0 ;; *) echo "Usage: hwclockset.sh {start|stop|reload|restart}" >&2 echo " start sets kernel (system) clock from hardware (RTC) clock" >&2 echo " stop, restart, reload and force-reload do nothing." >&2 echo " Refer to hwclock.sh as well." >&2 exit 1 ;; esac #!/bin/sh # # start/stop networking daemons. if ! [ -x /sbin/ifup ]; then exit 0 fi if [ -e /etc/network/spoof-protect ]; then . /etc/network/spoof-protect fi spoofprotect_rp_filter () { # This is the best method: turn on Source Address Verification and get # spoof protection on all current and future interfaces. if [ -e /proc/sys/net/ipv4/conf/all/rp_filter ]; then for f in /proc/sys/net/ipv4/conf/*/rp_filter; do echo 1 > $f done return 0 else return 1 fi } spoofprotect_ipfwadm () { # rules for linux 2.0.x and 2.1.x (x < 102) kernels # can't do ipfwadm based spoof protection if we don't have the appropriate # configuration info. if [ -z "$LOCAL_IPS" -o -z "$LOCAL_IFACES" ]; then return 1; fi #what about 127.0.0.0/8 ? #deny incoming packets pretending to be from our own system. #set your own IP address below (or use `hostname -i` to set it). if [ -e /proc/net/ip_input ]; then # delete and re-add entry (this way we don't get duplicate entries) for ip in $LOCAL_IPS; do for iface in $LOCAL_IFACES; do ipfwadm -I -d deny -o -P all -S $ip -W $iface -D 0/0 \ 2>/dev/null || true ipfwadm -I -i deny -o -P all -S $ip -W $iface -D 0/0 >/dev/null done done return 0 else return 1 fi } spoofprotect_ipchains () { # rules for linux 2.1.x (x > 101) kernels # can't do ipfwadm based spoof protection if we don't have the appropriate # configuration info. if [ -z "$LOCAL_IPS" ]; then return 1; fi if [ -e /proc/net/ip_fwchains ]; then for ip in $LOCAL_IPS; do ipchains -D input -j DENY -l -s $ip -i ! lo 2>/dev/null || true ipchains -A input -j DENY -l -s $ip -i ! lo done return 0 else return 1 fi } spoofprotect () { echo -n "Setting up IP spoofing protection: " if spoofprotect_rp_filter; then echo "rp_filter." elif spoofprotect_ipfwadm; then echo "ipfwadm." elif spoofprotect_ipchains; then echo "ipchains." else echo "FAILED" fi } ip_forward () { if [ -e /proc/sys/net/ipv4/ip_forward ]; then echo -n "Enabling packet forwarding: " echo 1 > /proc/sys/net/ipv4/ip_forward echo "done." fi } syncookies () { if [ -e /proc/sys/net/ipv4/tcp_syncookies ]; then echo -n "Enabling TCP/IP SYN cookies: " echo 1 > /proc/sys/net/ipv4/tcp_syncookies echo "done." fi } doopt () { optname=$1 default=$2 opt=`grep "^$optname=" /etc/network/options` if [ -z "$opt" ]; then opt="$optname=$default" fi optval=${opt#$optname=} if [ "$optval" = "yes" ]; then eval $optname fi } case "$1" in start) doopt spoofprotect yes doopt syncookies no doopt ip_forward no echo -n "Configuring network interfaces: " ifup -a echo "done." ;; stop) if sed -n 's/^[^ ]* \([^ ]*\) \([^ ]*\) .*$/\1 \2/p' /proc/mounts | grep -q "^/ nfs$" then echo "NOT deconfiguring network interfaces: / is an NFS mount" elif sed -n 's/^[^ ]* \([^ ]*\) \([^ ]*\) .*$/\1 \2/p' /proc/mounts | grep -q "^/ smbfs$" then echo "NOT deconfiguring network interfaces: / is an SMB mount" elif sed -n 's/^[^ ]* \([^ ]*\) \([^ ]*\) .*$/\2/p' /proc/mounts | grep -qE '^(nfs|smbfs)$' then echo "NOT deconfiguring network interfaces: NFS/SMB shares still mounted." else echo -n "Deconfiguring network interfaces: " ifdown -a echo "done." fi ;; reload) ;; force-reload) $0 restart ;; restart) echo -n "Reconfiguring network interfaces: " ifdown -a ifup -a echo "done." ;; *) echo "Usage: /etc/init.d/networking {start|stop|reload|restart}" exit 1 ;; esac exit 0 #!/bin/sh # Start/stop the cron daemon. test -f /usr/sbin/cron || exit 0 case "$1" in start) echo -n "Starting periodic command scheduler: cron" start-stop-daemon --start --quiet --exec /usr/sbin/cron echo "." ;; stop) echo -n "Stopping periodic command scheduler: cron" start-stop-daemon --stop --quiet --exec /usr/sbin/cron echo "." ;; restart) echo -n "Restarting periodic command scheduler: cron" start-stop-daemon --stop --quiet --exec /usr/sbin/cron start-stop-daemon --start --quiet --exec /usr/sbin/cron echo "." ;; reload|force-reload) echo -n "Reloading configuration files for periodic command scheduler: cron" # cron reloads automatically echo "." ;; *) echo "Usage: /etc/init.d/cron start|stop|restart|reload|force-reload" exit 1 ;; esac exit 0 #!/bin/sh # # start/stop inetd super server. if ! [ -x /usr/sbin/inetd ]; then exit 0 fi checkportmap () { if grep -v "^ *#" /etc/inetd.conf | grep 'rpc/' >/dev/null; then if ! [ -x /usr/bin/rpcinfo ] then echo echo "WARNING: rpcinfo not available - RPC services may be unavailable!" echo " (Commenting out the rpc services in inetd.conf will" echo " disable this message)" echo elif ! /usr/bin/rpcinfo -u localhost portmapper >/dev/null 2>/dev/null then echo echo "WARNING: portmapper inactive - RPC services unavailable!" echo " (Commenting out the rpc services in inetd.conf will" echo " disable this message)" echo fi fi } case "$1" in start) checkportmap echo -n "Starting internet superserver:" echo -n " inetd" ; start-stop-daemon --start --quiet --pidfile /var/run/inetd.pid --exec /usr/sbin/inetd echo "." ;; stop) echo -n "Stopping internet superserver:" echo -n " inetd" ; start-stop-daemon --stop --quiet --oknodo --pidfile /var/run/inetd.pid --exec /usr/sbin/inetd echo "." ;; reload) echo -n "Reloading internet superserver:" echo -n " inetd" start-stop-daemon --stop --quiet --oknodo --pidfile /var/run/inetd.pid --signal 1 echo "." ;; force-reload) $0 reload ;; restart) echo -n "Restarting internet superserver:" echo -n " inetd" start-stop-daemon --stop --quiet --oknodo --pidfile /var/run/inetd.pid checkportmap start-stop-daemon --start --quiet --pidfile /var/run/inetd.pid --exec /usr/sbin/inetd echo "." ;; *) echo "Usage: /etc/init.d/inetd {start|stop|reload|restart}" exit 1 ;; esac exit 0 #!/bin/sh # @(#)recover.script 8.7 (Berkeley) 8/16/94 # # Script to recover nvi edit sessions. # RECDIR=/var/tmp/vi.recover SENDMAIL=/usr/sbin/sendmail case "$1" in start) echo -n 'Recovering nvi editor sessions... ' # Check editor backup files. vibackup=`echo $RECDIR/vi.*` if [ "$vibackup" != "$RECDIR/vi.*" ]; then for i in $vibackup; do # Make sure we didn't lose the leading directory. This # would only happen if some loser is playing games with # embedded spaces in vi recovery file names i=$RECDIR/${i#$RECDIR/} # Only test files that are readable. if test ! -r $i; then continue fi # Unmodified nvi editor backup files either have the # execute bit set or are zero length. Delete them. if test -x $i -o ! -s $i; then rm $i fi done fi # It is possible to get incomplete recovery files, if the editor crashes # at the right time. virecovery=`echo $RECDIR/recover.*` if [ "$virecovery" != "$RECDIR/recover.*" ]; then for i in $virecovery; do # Make sure we didn't lose the leading directory. This # would only happen if some loser is playing games with # embedded spaces in vi recovery file names i=$RECDIR/${i#$RECDIR/} # Only test files that are readable. if test ! -r $i; then continue fi # Delete any recovery files that are zero length, corrupted, # or that have no corresponding backup file. Else send mail # to the user. recfile=`awk '/^X-vi-recover-path:/{print $2}' < $i` if test -n "$recfile" -a -s "$recfile"; then ($SENDMAIL -t < $i &) /dev/null 2>&0 else rm $i fi done fi echo "done." ;; stop|restart|reload|force-reload) ;; esac exit 0 #! /bin/sh # /etc/init.d/exim # # Written by Miquel van Smoorenburg . # Modified for Debian GNU/Linux by Ian Murdock . # Modified for exim by Tim Cutts set -e # Exit if exim runs from /etc/inetd.conf if [ -f /etc/inetd.conf ] && grep -q "^ *smtp" /etc/inetd.conf; then exit 0 fi DAEMON=/usr/sbin/exim NAME=exim test -x $DAEMON || exit 0 case "$1" in start) echo -n "Starting MTA: " start-stop-daemon --start --pidfile /var/run/exim/exim.pid \ --exec $DAEMON -- -bd -q30m echo "exim." ;; stop) echo -n "Stopping MTA: " start-stop-daemon --stop --pidfile /var/run/exim/exim.pid \ --oknodo --retry 30 --exec $DAEMON echo "exim." ;; restart) echo -n "Restarting MTA: " start-stop-daemon --stop --pidfile /var/run/exim/exim.pid \ --oknodo --retry 30 --exec $DAEMON start-stop-daemon --start --pidfile /var/run/exim/exim.pid \ --exec $DAEMON -- -bd -q30m echo "exim." ;; reload|force-reload) echo "Reloading $NAME configuration files" start-stop-daemon --stop --pidfile /var/run/exim/exim.pid \ --signal 1 --exec $DAEMON ;; *) echo "Usage: /etc/init.d/$NAME {start|stop|restart|reload}" exit 1 ;; esac exit 0 #!/bin/sh -e case "$1" in start|restart) if [ -e /etc/network/ifstate ]; then echo -n "Cleaning: /etc/network/ifstate" echo -n >/etc/network/ifstate echo "." fi ;; stop|reload|force-reload) ;; esac #! /bin/sh # # This file was automatically customized by debmake on Thu, 20 Feb 1997 17:33:12 +0100 # # Written by Miquel van Smoorenburg . # Modified for Debian GNU/Linux by Ian Murdock . # Modified for Debian by Christoph Lameter . # Modified for Debian GNU/Linux by Martin Schulze . PATH=/bin:/usr/bin:/sbin:/usr/sbin DAEMON=/usr/sbin/atd PIDFILE=/var/run/atd.pid # Arguments to atd # ARGS="" test -x $DAEMON || exit 0 case "$1" in start) echo -n "Starting deferred execution scheduler: atd" start-stop-daemon --start --quiet --pidfile $PIDFILE --exec $DAEMON -- $ARGS echo "." ;; stop) echo -n "Stopping deferred execution scheduler: atd" start-stop-daemon --stop --quiet --pidfile $PIDFILE --exec $DAEMON echo "." ;; reload) echo "Not implemented." ;; force-reload|restart) sh $0 stop sh $0 start ;; *) echo "Usage: /etc/init.d/atd {start|stop|restart|force-reload|reload}" exit 1 ;; esac exit 0 #!/bin/sh # # /etc/init.d/ppp: start or stop PPP link. # # If you want PPP started on boot time (most dialup systems won't need it) # rename the /etc/ppp/no_ppp_on_boot file to /etc/ppp/ppp_on_boot, and # follow the instructions in the comments in that file. test -x /usr/sbin/pppd -a -f /etc/ppp/ppp_on_boot || exit 0 if [ -x /etc/ppp/ppp_on_boot ]; then RUNFILE=1; fi case "$1" in start) echo -n "Starting up PPP link: pppd" if [ "$RUNFILE" = "1" ]; then /etc/ppp/ppp_on_boot else pppd call provider fi echo "." ;; stop) echo -n "Shutting down PPP link: pppd" if [ "$RUNFILE" = "1" ]; then poff else poff provider fi echo "." ;; restart|force-reload) echo -n "Restarting PPP link: pppd" if [ "$RUNFILE" = "1" ]; then poff sleep 5 /etc/ppp/ppp_on_boot else poff provider sleep 5 pppd call provider fi echo "." ;; *) echo "Usage: /etc/init.d/ppp {start|stop|restart|force-reload}" exit 1 ;; esac exit 0 #! /bin/sh # dns-clean by John Hasler Wed Jun 30 1999. You may treat # this program as if it was in the public domain. # This script should be run at bootup to clean up any mess left by 0dns-up. # It should be run before ppp is started. # It should never be run while ppp is up. PATH=/usr/local/sbin:/usr/local/bin:/sbin:/bin:/usr/sbin:/usr/bin test -f /usr/sbin/pppconfig || exit 0 case "$1" in start) /bin/echo -n "Running 0dns-down to make sure resolv.conf is ok..." /etc/ppp/ip-down.d/0dns-down && /bin/echo "done." ;; stop|restart|force-reload) ;; *) ;; esac exit 0 #! /bin/sh # /etc/init.d/klogd: start the kernel log daemon. PATH=/bin:/usr/bin:/sbin:/usr/sbin pidfile=/var/run/klogd.pid binpath=/sbin/klogd test -f $binpath || exit 0 # Use KLOGD="-k /boot/System.map-$(uname -r)" to specify System.map # KLOGD="" running() { # No pidfile, probably no daemon present # if [ ! -f $pidfile ] then return 1 fi pid=`cat $pidfile` # No pid, probably no daemon present # if [ -z "$pid" ] then return 1 fi cmd=`cat /proc/$pid/cmdline | tr "\000" "\n"|head -1` # No syslogd? # if [ "$cmd" != "$binpath" ] then return 1 fi return 0 } case "$1" in start) echo -n "Starting kernel log daemon: klogd" start-stop-daemon --start --quiet --exec $binpath -- $KLOGD echo "." ;; stop) echo -n "Stopping kernel log daemon: klogd" start-stop-daemon --stop --quiet --exec $binpath --pidfile $pidfile echo "." ;; restart|force-reload) echo -n "Stopping kernel log daemon: klogd" start-stop-daemon --stop --quiet --exec $binpath --pidfile $pidfile echo "." sleep 1 echo -n "Starting kernel log daemon: klogd" start-stop-daemon --start --quiet --exec $binpath --exec $binpath -- $KLOGD echo "." ;; reload-or-restart) if running then start-stop-daemon --stop --quiet --signal 1 --exec $binpath --pidfile $pidfile else start-stop-daemon --start --quiet --exec $binpath -- $KLOGD fi ;; *) echo "Usage: /etc/init.d/klogd {start|stop|restart|force-reload|reload-or-restart}" exit 1 esac exit 0 #! /bin/sh # /etc/init.d/sysklogd: start the system log daemon. PATH=/bin:/usr/bin:/sbin:/usr/sbin pidfile=/var/run/syslogd.pid binpath=/sbin/syslogd test -x $binpath || exit 0 # Options for start/restart the daemons # For remote UDP logging use SYSLOGD="-r" # SYSLOGD="" create_xconsole() { if [ ! -e /dev/xconsole ]; then mknod -m 640 /dev/xconsole p else chmod 0640 /dev/xconsole fi chown root.adm /dev/xconsole } running() { # No pidfile, probably no daemon present # if [ ! -f $pidfile ] then return 1 fi pid=`cat $pidfile` # No pid, probably no daemon present # if [ -z "$pid" ] then return 1 fi cmd=`cat /proc/$pid/cmdline | tr "\000" "\n"|head -1` # No syslogd? # if [ "$cmd" != "$binpath" ] then return 1 fi return 0 } case "$1" in start) echo -n "Starting system log daemon: syslogd" create_xconsole start-stop-daemon --start --quiet --exec $binpath -- $SYSLOGD echo "." ;; stop) echo -n "Stopping system log daemon: syslogd" start-stop-daemon --stop --quiet --exec $binpath --pidfile $pidfile echo "." ;; reload|force-reload) start-stop-daemon --stop --quiet --signal 1 --exec $binpath --pidfile $pidfile ;; restart) echo -n "Stopping system log daemon: syslogd" start-stop-daemon --stop --quiet --exec $binpath --pidfile $pidfile echo "." sleep 1 echo -n "Starting system log daemon: syslogd" start-stop-daemon --start --quiet --exec $binpath -- $SYSLOGD echo "." ;; reload-or-restart) if running then start-stop-daemon --stop --quiet --signal 1 --exec $binpath --pidfile $pidfile else start-stop-daemon --start --quiet --exec $binpath -- $SYSLOGD fi ;; *) echo "Usage: /etc/init.d/sysklogd {start|stop|reload|restart|force-reload|reload-or-restart}" exit 1 esac exit 0 #!/bin/sh set -e PATH=/usr/local/sbin:/usr/local/bin:/sbin:/bin:/usr/sbin:/usr/bin default=/etc/default/iptables if test -f $default; then . $default fi have_a_cow_man () { for i in $@; do if ! command -v "$i" >/dev/null 2>&1; then echo "Aborting iptables initd: no $i executable." exit 0 fi done } iptables="/sbin/${iptables_command-iptables}" iptables_save="${iptables}-save" iptables_restore="${iptables}-restore" have_a_cow_man "$iptables_save" "$iptables_restore" libdir=/var/lib/iptables autosave="${libdir}/autosave" initd="$0" initd_clear () { rm -f "$autosave" echo -n "Clearing iptables ruleset: default ACCEPT policy" $iptables_save | sed "/-/d;/^#/d;s/DROP/ACCEPT/" | $iptables_restore echo "." } initd_halt () { rm -f $autosave echo -n "Clearing iptables ruleset: default DROP policy" $iptables_save | sed "/-/d;/^#/d;s/ACCEPT/DROP/" | $iptables_restore echo "." } initd_load () { ruleset="$libdir/$@" if ! test -f "$ruleset"; then echo "Aborting iptables load: unknown ruleset, \"$@\"." if ! test "${ruleset#${libdir}/}" = active -o inactive; then usage fi exit 0 fi if test "${ruleset#${libdir}/}" = inactive; then initd_autosave fi rm -f "$autosave" echo -n "Loading iptables ruleset: load \"$@\"" $iptables_restore < "$ruleset" echo "." } initd_counters () { if test "${enable_save_counters:-false}" = true; then echo -n " with counters" $iptables_save -c > "$ruleset" else $iptables_save | sed '/^:/s@\[[0-9]\{1,\}:[0-9]\{1,\}\]@[0:0]@g' \ > "$ruleset" fi } initd_save () { rm -f $autosave ruleset="${libdir}/$@" echo -n "Savinging iptables ruleset: save \"$@\"" initd_counters echo "." } initd_autosave () { if test -f $autosave -a ${enable_autosave-false} = true; then ruleset="${libdir}/active" echo -n "Autosaving iptables ruleset: save \"active\"" initd_counters echo "." fi } usage () { current="$(ls -m /var/lib/iptables \ | sed 's/ \{0,1\}autosave,\{0,1\} \{0,1\}//')" cat << END $initd options: start|restart|reload|force-reload load the "active" ruleset save save the current ruleset load load a ruleset stop load the "inactive" ruleset clear remove all rules and user-defined chains, set default policy to ACCEPT halt remove all rules and user-defined chains, set default policy to DROP Saved rulesets: $current Please read: $default END } case "$1" in start|restart|reload|force-reload) initd_load active if test ${enable_autosave-false} = true; then touch $autosave fi ;; stop) initd_load inactive ;; clear) initd_clear ;; halt) initd_halt ;; save) shift initd_save "$@" ;; load) shift initd_load "$@" ;; save_active) #legacy option initd_save active ;; save_inactive) #legacy option initd_save inactive ;; *) if test "$@"; then echo "Aborting iptables initd: unknown command(s): \"$@\"." fi usage ;; esac exit 0 #!/bin/sh # # This is the boot script for the `console-tools' package. # # It loads parameters from /etc/console-tools/config, maybe loads # default screen-font, screen font-map, and application charset-map, # and maybe start "vcstime" # # (c) 1997 Yann Dirson if [ -r /etc/console-tools/config ] ; then . /etc/console-tools/config fi SETFONT="/usr/bin/consolechars" SETFONT_OPT="" CHARSET="/usr/bin/charset" VCSTIME="/usr/sbin/vcstime" # be sure the main program is installed [ -x "${SETFONT}" ] || exit 0 # set DEVICE_PREFIX depending on devfs if [ "`grep -c devfs /proc/filesystems`" -a -d /dev/vc ]; then DEVICE_PREFIX="/dev/vc/" else DEVICE_PREFIX="/dev/tty" fi reset_vga_palette () { if ! /usr/bin/tty | grep -q ttyS ; then # not a serial console. if [ -f /proc/fb ]; then # They have a framebuffer device. # That means we have work to do... echo -n "]R" fi fi } setup () { reset_vga_palette # start vcstime if [ "${DO_VCSTIME}" = "yes" -a -x ${VCSTIME} ] ; then echo -n Starting clock on text console: `basename ${VCSTIME}` ${VCSTIME} & echo . fi # Global default font+sfm if [ "${SCREEN_FONT}" ] then echo -n "Setting up general console font... " SCREEN_FONT="-f ${SCREEN_FONT}" # maybe use an external SFM [ "${SCREEN_FONT_MAP}" ] && SCREEN_FONT_MAP="-u ${SCREEN_FONT_MAP}" ${SETFONT} ${SETFONT_OPT} ${SCREEN_FONT} ${SCREEN_FONT_MAP} && echo done. fi # Per-VC font+sfm PERVC_FONTS=`set | grep "^SCREEN_FONT_vc[0-9]*="` if [ "${PERVC_FONTS}" ] then echo -n "Setting up per-VC fonts: " for font in ${PERVC_FONTS} do # extract VC and FONTNAME info from variable setting font=`echo $font | cut -c15-` vc=`echo $font | cut -d= -f1` font=`echo $font | cut -d= -f2` echo -n "${DEVICE_PREFIX}${vc}, " # eventually find an associated SFM eval sfm=\${SCREEN_FONT_MAP_vc${vc}} [ "$sfm" ] && sfm="-u $sfm" ${SETFONT} --tty=${DEVICE_PREFIX}$vc ${SETFONT_OPT} -f $font $sfm done echo "done." fi # Global ACM [ "${APP_CHARSET_MAP}" ] && ${CHARSET} G0 ${APP_CHARSET_MAP} # Per-VC ACMs PERVC_ACMS=`set | grep "^APP_CHARSET_MAP_vc[0-9]*="` if [ "${PERVC_ACMS}" ] then echo -n "Setting up per-VC ACM's: " for acm in ${PERVC_ACMS} do # extract VC and FONTNAME info from variable setting acm=`echo $acm | cut -c19-` vc=`echo $acm | cut -d= -f1` acm=`echo $acm | cut -d= -f2` echo -n "${DEVICE_PREFIX}${vc} ($acm), " ${CHARSET} --tty=${DEVICE_PREFIX}$vc G0 $acm done echo "done." fi } case "$1" in start|reload|restart|force-reload) setup ;; stop) ;; *) setup ;; esac #!/bin/sh # # Load the keymaps *as soon as possible* # command -v loadkeys >/dev/null 2>&1 || exit 0 CONFDIR=/etc/console CONFFILEROOT=boottime EXT=kmap #KERNEL_KEYMAP=/var/state/misc/kernel.${EXT} case "$1" in start | restart | force-reload | reload) # # save kernel keymap # if [ -d ${KERNEL_KEYMAP%/*} -a ! -r ${KERNEL_KEYMAP} ] # then # /usr/bin/dumpkeys > ${KERNEL_KEYMAP} # fi # load new map if [ -r ${CONFDIR}/${CONFFILEROOT}.${EXT}.gz ] ; then loadkeys ${CONFDIR}/${CONFFILEROOT}.${EXT}.gz fi ;; stop) # # ensure the saved kernel keymap is removed before halt/reboot # rm -f ${KERNEL_KEYMAP} ;; *) echo "Usage: $0 {start|stop|restart|reload|force-reload}" exit 1 ;; esac #! /bin/sh # /etc/rc.serial # Initializes the serial ports on your system # # chkconfig: 2345 50 75 # description: This initializes the settings of the serial port # # Distributed with setserial version 2.15 # # XXXX note: as of 2.15, the autosave feature doesn't work if you are # using the multiport feature; it doesn't save the multiport configuration # (for now). Autosave also doesn't work for the hayes devices. #Will fix later... # # SETSERIAL=/bin/setserial modconf=/var/run/setserial.conf # If the serial executable has been removed abort the configuration [ -x ${SETSERIAL} ] || exit 0 # # make sure that a serial device is loaded... # insmod -k serial 2>/dev/null # # # Support devfs when it arrives. # if /bin/ls /dev/tts 2> /dev/null 1>&2 ; then ALLDEVS="/dev/tts/*" else # No devfs - old naming scheme ALLDEVS="/dev/ttyS?" if /bin/ls /dev/ttyS?? 2> /dev/null 1>&2 ; then ALLDEVS="$ALLDEVS /dev/ttyS??" fi fi # # Handle System V init conventions... # case $1 in start | restart | force-reload ) action="start"; ;; stop) action="stop"; ;; modload) action="modload"; ;; modsave) action="modsave"; ;; *) action="start"; esac if test $action = modload ; then echo "Restoring persistent state of serial.o module due to module reload... " if test -f ${modconf} ; then while read device args do case "$device" in ""|\#*) continue ;; esac ${SETSERIAL} -z $device $args done < ${modconf} else echo "Warning - no module state found (ok if this is at bootup)" echo "Using the bootup configuration instead." action="start"; fi exit 0 fi if test $action = stop ; then if test "`head -1 /etc/serial.conf`X" = "###AUTOSAVE###X" ; then echo -n "Saving state of known serial devices... " grep "^#" /etc/serial.conf > /etc/.serial.conf.new ${SETSERIAL} -G -g ${ALLDEVS} | grep -v "uart unknown\|pcmcia" >> /etc/.serial.conf.new echo -n "backing up serial.conf" mv /etc/serial.conf /etc/.serial.conf.old mv /etc/.serial.conf.new /etc/serial.conf echo " done." elif test "`head -1 /etc/serial.conf`X" = "###AUTOSAVE-FULL###X" ; then echo -n "Saving state (including unknowns) of serial devices... " grep "^#" /etc/serial.conf > /etc/.serial.conf.new ${SETSERIAL} -G -g ${ALLDEVS} | grep -v "pcmcia" >> /etc/.serial.conf.new echo -n "backing up serial.conf" mv /etc/serial.conf /etc/.serial.conf.old mv /etc/.serial.conf.new /etc/serial.conf echo " done." elif test "`head -1 /etc/serial.conf`X" = "###AUTOSAVE-ONCE###X" ; then echo -n "Saving state of known serial devices... " echo "###PORT STATE GENERATED USING AUTOSAVE-ONCE###" > /etc/.serial.conf.new grep "^#" /etc/serial.conf >> /etc/.serial.conf.new ${SETSERIAL} -G -g ${ALLDEVS} | grep -v "uart unknown" >> /etc/.serial.conf.new echo -n "backing up serial.conf" mv /etc/serial.conf /etc/.serial.conf.old mv /etc/.serial.conf.new /etc/serial.conf echo " done." fi exit 0 fi # # Is it Start # if test $action = start ; then echo "Loading the saved-state of the serial devices... " rm -f ${modconf} if test -f /etc/serial.conf ; then while read device args do case "$device" in ""|\#*) continue ;; esac ${SETSERIAL} -z $device $args ${SETSERIAL} -bg $device done < /etc/serial.conf else echo "###AUTOSAVE###" > /etc/serial.conf fi fi if test $action = modsave ; then echo -n "Saving serial.o state to emulate module data persistence... " rm -f ${modconf} ${SETSERIAL} -G -g ${ALLDEVS} | grep -v "uart unknown\|pcmcia" > ${modconf} echo "done." exit 0 fi #!/bin/bash # # /etc/init.d/zebra -- start/stop the Zebra routing daemons # # Written by Endre Hirling PATH=/bin:/usr/bin:/sbin:/usr/sbin D_PATH=/usr/sbin C_PATH=/etc/zebra DAEMONS="zebra bgpd ripd ripngd ospfd ospf6d" # Pidfile name pidfile() { echo "/var/run/$1.pid" } # Check if daemon is started (by # checking for the pidfile) started() { [ -e `pidfile $1` ] && return 0 return 1 } # Start the daemon given in the # parameter, printing its name to the # terminal start() { echo -n " $1" start-stop-daemon --start --exec "$D_PATH/$1" -- -d } # Stop the daemon given in the # parameter, printing its name to the # terminal stop() { if ! started "$1" ; then echo -n " ($1)" return 0 else echo -n " $1" start-stop-daemon --stop --quiet --oknodo --exec "$D_PATH/$1" rm -f `pidfile $1` fi } # Check if the daemon's executable and # config files are there check() { [ -x "$D_PATH/$1" ] || return 1 [ -r "$C_PATH/$1.conf" ] || return 1 return 0 } # Check if the daemon is to be run at # the current priority checkprio() { cp_tp=${!1} [ "$cp_tp" = "no" ] && return 1 cp_tp="${cp_tp/#yes/10}" expr "$cp_tp" '<=' "$prio" >/dev/null 2>&1 case $? in 0) return 0 ;; 1) return 1 ;; 2) echo "Invalid priority for $D, not starting." return 1 ;; esac } # Stops all daemons not to be run at # current priority (priority greater # than current) stop_prio() { echo -n "Stopping Zebra daemons (prio:$prio):" for i in $DAEMONS; do if ! checkprio $i ; then stop "$i" fi done echo "." } # Starts all daemons with priority less # than the current start_prio() { echo -n "Starting Zebra daemons (prio:$prio):" for i in $DAEMONS; do if checkprio $i ; then start "$i" fi done echo "." } # Main program # for i in $DAEMONS;do eval "$i=no";done # Load configuration and check if zebra # can be started [ ! -r "$C_PATH/daemons" ] && exit 0 . "$C_PATH/daemons" # Set priority of un-startable daemons # to 'no' for D in $DAEMONS; do if ! check $D ; then eval "$D=no" fi done case "$1" in # Start all daemons if 'start' or priority 10 is given start|10) prio=${2:-"10"} start_prio ;; # Stop/start daemons for the appropriate priority level [1-9]) prio="$1" stop_prio start_prio ;; # Stop all daemons at level '0' or 'stop' stop|0) echo -n "Stopping Zebra daemons:" for i in $DAEMONS zebra; do stop "$i" done echo "." ;; restart|force-reload) $0 stop sleep 1 $0 start ;; *) echo "Usage: /etc/init.d/zebra {start|stop|restart|force-reload|}" echo " Read /usr/doc/zebra/README.Debian for details." exit 1 ;; esac exit 0 #!/bin/sh PATH=/sbin:/bin:/usr/sbin:/usr/bin test -x /usr/sbin/named || exit 0 start () { echo -n "Starting domain name service: named" start-stop-daemon --start --quiet \ --pidfile /var/run/named.pid --exec /usr/sbin/named echo "." } stop () { echo -n "Stopping domain name service: named" # --exec doesn't catch daemons running deleted instances of named, # as in an upgrade. Fortunately, --pidfile is only going to hit # things from the pidfile. start-stop-daemon --stop --quiet \ --pidfile /var/run/named.pid --name named echo "." } case "$1" in start) start ;; stop) stop ;; restart|force-reload) stop sleep 2 start ;; reload) /usr/sbin/ndc reload ;; *) echo "Usage: /etc/init.d/bind {start|stop|reload|restart|force-reload}" >&2 exit 1 ;; esac exit 0 #! /bin/sh -e test -x /usr/sbin/acpid || exit 0 test -d /proc/acpi || exit 0 case "$1" in start) echo -n "Starting Advanced Configuration and Power Interface daemon: " start-stop-daemon --start --quiet --exec /usr/sbin/acpid -- -c /etc/acpi/events -s /var/run/.acpid.socket echo "acpid." ;; stop) echo -n "Stopping Advanced Configuration and Power Interface daemon: " start-stop-daemon --stop --quiet --oknodo --exec /usr/sbin/acpid echo "acpid." ;; restart) $0 stop $0 start ;; reload|force-reload) echo "Reloading Advanced Configuration and Power Interface daemon configuration files" start-stop-daemon --stop --signal 1 --exec /usr/sbin/acpid ;; *) echo "Usage: /etc/init.d/acpid {start|stop|restart|reload|force-reload}" exit 1 esac exit 0 # /etc/modules: kernel modules to load at boot time. # # This file should contain the names of kernel modules that are # to be loaded at boot time, one per line. Comments begin with # a "#", and everything on the line after them are ignored. 3.0 order hosts,bind multi on # /etc/inputrc - global inputrc for libreadline # See readline(3readline) and `info rluserman' for more information. # Be 8 bit clean. set input-meta on set output-meta on # To allow the use of 8bit-characters like the german umlauts, comment out # the line below. However this makes the meta key not work as a meta key, # which is annoying to those which don't need to type in 8-bit characters. # set convert-meta off Debian GNU/\s 3.0 \n \l Debian GNU/%s 3.0 %h # /etc/nsswitch.conf # # Example configuration of GNU Name Service Switch functionality. # If you have the `glibc-doc' and `info' packages installed, try: # `info libc "Name Service Switch"' for information about this file. passwd: compat group: compat shadow: compat hosts: files dns networks: files protocols: db files services: db files ethers: db files rpc: db files netgroup: nis # /etc/profile: system-wide .profile file for the Bourne shell (sh(1)) # and Bourne compatible shells (bash(1), ksh(1), ash(1), ...). PATH="/usr/local/bin:/usr/bin:/bin:/usr/bin/X11:/usr/games" if [ "$BASH" ]; then PS1='\u@\h:\w\$ ' else if [ "`id -u`" -eq 0 ]; then PS1='# ' else PS1='$ ' fi fi export PATH PS1 umask 022 # System-wide .bashrc file for interactive bash(1) shells. shopt -s checkwinsize # enable bash completion in interactive shells #if [ "$PS1" -a -f /etc/bash_completion ]; then # . /etc/bash_completion #fi N . ..modutilsOinit.d|modulesdefault>+ skel}debian_version~ host.confinputrcissue issue.net nsswitch.confprofilebash_completion.d bash.bashrcbash_completionA+ apt debconf.confC+ alternativesd+ dpkg# cron.daily updatedb.confg+security-pam.dpam.conf login.defs securettym+terminfoshells sysctl.conf+rc0.dGrc1.dUrcS.dirc2.dwrc3.drc4.drc5.drc6.d+rc.boot rmtfstab mtabpasswd ld.so.cache motd+ optadjtime localtimeinittab modules.conf adduser.conflogrotate.conf rpcgroup+console+ ldap logrotate.d hosts.allow ssl cron.weekly cron.monthly+cron.dcrontab hosts.denyemail-addressesmail.rcmanpath.configat.denynetwork+groffgateways protocolsservices syslog.conf inittab.realhostnamehosts resolv.conf lilo.conf inetd.conf sshwgetrc+ chatscriptsmodules.conf.old deluser.conf serial.confchecksecurity.conf .pwd.lockpasswd-locale.nopurge+zebratimezone cdebconf.conf ioctl.save adduser.conf.dpkg-savegroup-iproute2 bindshadowgshadow apm acpi ppp1(ntp.confmagic.dpkg-newKmagic# bash_completion - some programmable completion functions for bash 2.05a # # $Id: bash_completion,v 1.264 2002/04/08 16:30:59 ianmacd Exp $ # # Copyright (C) Ian Macdonald # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software Foundation, # Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # RELEASE: 20020408 [ -n "$DEBUG" ] && set -v || set +v # Alter the following to reflect the location of this file # [ -z "$BASH_COMPLETION" ] && declare -r BASH_COMPLETION=/etc/bash_completion [ -z "$BASH_COMPLETION_DIR" ] && \ declare -r BASH_COMPLETION_DIR=/etc/bash_completion.d # Set a couple of useful vars # OS=$( uname -s ) RELEASE=$( uname -r ) if [ ${BASH_VERSINFO[1]} '>' 04 ]; then default="-o default" dirnames="-o dirnames" filenames="-o filenames" fi [ ${BASH_VERSINFO[1]} = "05b" ] && nospace="-o nospace" # Turn on extended globbing and programmable completion shopt -s extglob progcomp # A lot of the following one-liners were taken directly from the # completion examples provided with the bash 2.04 source distribution # Make directory commands see only directories complete -d pushd # The following section lists completions that are redefined later # Do NOT break these over multiple lines. # # START exclude -- do NOT remove this line complete -f -X '!*.bz2' bunzip2 bzcat bzcmp bzdiff bzegrep bzfgrep bzgrep complete -f -X '!*.@(zip|ZIP|jar|JAR|exe|EXE|pk3)' unzip complete -f -X '*.Z' compress znew complete -f -X '!*.@(Z|gz|tgz|Gz)' gunzip zcmp zdiff zcat zegrep zfgrep zgrep zless zmore complete -f -X '!*.Z' uncompress complete -f -X '!*.@(gif|jp?(e)g|tif?(f)|png|p[bgp]m|bmp|xpm|ico|GIF|JPG|JP?(E)G|TIF?(F)|PNG|P[BGP]M|BMP|XPM|ICO)' ee display complete -f -X '!*.@(gif|jp?(e)g|tif?(f)|png|p[bgp]m|bmp|xpm|GIF|JPG|JP?(E)G|TIF?(F)|PNG|P[BGP]M|BMP|XPM)' xv qiv complete -f -X '!*.@(@(?(e)ps|?(E)PS|pdf|PDF)?(.gz|.GZ|.Z))' gv ggv complete -f -X '!*.@(dvi|DVI)?(.@(gz|Z|bz2))' xdvi complete -f -X '!*.@(dvi|DVI)' dvips dviselect dvitype complete -f -X '!*.@(pdf|PDF)' acroread xpdf complete -f -X '!*.texi*' makeinfo texi2dvi texi2html complete -f -X '!*.@(tex|TEX)' tex latex slitex jadetex pdfjadetex pdftex pdflatex complete -f -X '!*.@(mp3|MP3)' mpg123 complete -f -X '!*.@(mpg|mpeg|avi|asf|vob|bin|vcd|ps|pes|fli|viv|rm|ram|yuv|mov|wmv)' mplayer complete -f -X '!*.@(avi|asf)' aviplay complete -f -X '!*.@(rm|ram|smi?(l))' realplay complete -f -X '!*.@(mpg|mpeg|avi|mov)' xanim complete -f -X '!*.@(ogg|OGG)' ogg123 complete -f -X '!*.@(mp3|MP3|ogg|OGG|pls|m3u)' xmms gqmpeg freeamp complete -f -X '!*.fig' xfig complete -f -X '!*.@(mid?(i))' timidity playmidi complete -f -X '*.@(o|so|so.*|a|tar|?(t)gz|?(t)bz2|rpm|zip|ZIP|gif|GIF|jp?(e)g|JP?(E)G|mp3|MP3|mpg|MPG|avi|AVI|asf|ASF' vi vim emacs complete -f -X '!*.@(exe|EXE|com|COM)' wine # FINISH exclude -- do not remove this line # start of section containing compspecs that can be handled within bash # user commands see only users complete -u finger su usermod userdel passwd chage write talk chfn # group commands see only groups [ ${BASH_VERSINFO[1]} '>' 04 ] && complete -g groupmod groupdel # bg completes with stopped jobs complete -A stopped -P '%' bg # other job commands complete -j -P '%' fg jobs disown # readonly and unset complete with shell variables complete -v readonly unset # set completes with set options complete -A setopt set # shopt completes with shopt options complete -A shopt shopt # helptopics complete -A helptopic help # unalias completes with aliases complete -a unalias # bind completes with readline bindings (make this more intelligent) complete -A binding bind # type and which complete on commands complete -c command type which # start of section containing completion functions called by other functions # This function checks whether we have a given programs on the system. # No need for bulky functions in memory if we don't. # have() { unset -v have type $1 &> /dev/null [ $? -eq 0 ] && have="yes" } # This function performs file and directory completion. It's better than # simply using 'compgen -f', because it honours spaces in filenames # _filedir() { local IFS=$'\t\n' _expand || return 0 if [ "$1" = -d ]; then COMPREPLY=( ${COMPREPLY[@]} $( compgen -d -- $cur ) ) return 0 fi COMPREPLY=( ${COMPREPLY[@]} $( eval compgen -f -- \"$cur\" ) ) } # This function completes on signal names # _signals() { local i # standard signal completion is rather braindead, so we need # to hack around to get what we want here, which is to # complete on a dash, followed by the signal name minus # the SIG prefix COMPREPLY=( $( compgen -A signal SIG${cur#-} )) for (( i=0; i < ${#COMPREPLY[@]}; i++ )); do COMPREPLY[i]=-${COMPREPLY[i]#SIG} done } # This function expands tildes in pathnames # _expand() { [ "$cur" != "${cur%\\}" ] && cur="$cur"'\' # expand ~username type directory specifications if [[ "$cur" == \~*/* ]]; then eval cur=$cur elif [[ "$cur" == \~* ]]; then cur=${cur#\~} COMPREPLY=( $( compgen -P '~' -u $cur ) ) return ${#COMPREPLY[@]} fi } # This function completes on process IDs # _pids() { COMPREPLY=( $( compgen -W '$( ps axo pid | sed 1d )' -- $cur ) ) } # This function completes on process group IDs # _pgids() { COMPREPLY=( $( compgen -W '$( ps axo pgid | sed 1d )' -- $cur ) ) } # start of section containing completion functions for bash built-ins # bash alias completion # _alias() { local cur COMPREPLY=() cur=${COMP_WORDS[$COMP_CWORD]}; case "$COMP_LINE" in *[^=]) COMPREPLY=( $( compgen -A alias -S '=' -- $cur ) ) ;; *=) COMPREPLY=( "$( alias ${cur%=} 2>/dev/null | \ sed -e 's|^alias '$cur'\(.*\)$|\1|' )" ) ;; esac } complete -F _alias alias # bash export completion # _export() { local cur COMPREPLY=() cur=${COMP_WORDS[$COMP_CWORD]}; case "$COMP_LINE" in *[^=]) COMPREPLY=( $( compgen -v -S '=' -- $cur ) ) ;; *=) COMPREPLY=( $( eval echo $`echo ${cur%=}` ) ) ;; esac } complete -F _export $default export # bash shell function completion # _function() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} if [[ $1 == @(declare|typeset) ]]; then if [ "$prev" = -f ]; then COMPREPLY=( $( compgen -A function -- $cur ) ) elif [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '-a -f -F -i -r -x -p' -- \ $cur ) ) fi elif [ $COMP_CWORD -eq 1 ]; then COMPREPLY=( $( compgen -A function -- $cur ) ) else COMPREPLY=( "() $( type -- ${COMP_WORDS[1]} | sed -e 1,2d )" ) fi } complete -F _function function declare typeset # start of section containing completion functions for external programs # chown(1) completion # _chown() { local cur prev user group i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} # do not attempt completion if we're specifying an option [[ "$cur" == -* ]] && return 0 # first parameter on line or first since an option? if [ $COMP_CWORD -eq 1 ] || [[ "$prev" == -* ]]; then if [[ "$cur" == [a-zA-Z]*[.:]* ]] && \ [ ${BASH_VERSINFO[1]} '>' 04 ]; then user=${cur%%?(\\)[.:]*} group=${cur#*[.:]} COMPREPLY=( $( compgen -P $user'\:' -g -- $group ) ) else COMPREPLY=( $( compgen -S '\:' -u $cur ) ) fi fi return 0 } complete -F _chown $default chown # chgrp(1) completion # _chgrp() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} # first parameter on line or first since an option? if [ $COMP_CWORD -eq 1 ] && [[ "$cur" != -* ]] || \ [[ "$prev" == -* ]]; then [ ${BASH_VERSINFO[1]} '>' 04 ] && \ COMPREPLY=( $( compgen -g $cur ) ) else _expand || return 0 fi return 0 } complete -F _chgrp $default chgrp # umount(8) completion. This relies on the mount point being the third # space-delimited field in the output of mount(8) # _umount() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} COMPREPLY=( $( compgen -W '$( mount | cut -d" " -f 3 )' -- $cur ) ) return 0 } complete -F _umount $dirnames umount # mount(8) completion. This will pull a list of possible mounts out of # /etc/fstab, unless the word being completed contains a ':', which # would indicate the specification of an NFS server. In that case, we # query the server for a list of all available exports and complete on # that instead. # _mount() { local cur i sm COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} for i in {,/usr}/{,s}bin/showmount; do [ -x $i ] && sm=$i && break; done if [ -n "$sm" ] && [[ "$cur" == *:* ]]; then COMPREPLY=( $( $sm -e ${cur%%:*} | sed 1d | \ grep ^${cur#*:} | awk '{print $1}' ) ) else COMPREPLY=( $( awk '{if ($2 ~ /\//) print $2}' /etc/fstab | \ grep "^$cur" ) ) fi return 0 } complete -F _mount $default mount # Linux rmmod(1) completion. This completes on a list of all currently # installed kernel modules. # [ $OS = Linux ] && _rmmod() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} COMPREPLY=( $( /sbin/lsmod | \ awk '{if (NR != 1 && $1 ~ /^'$cur'/) print $1}' ) ) return 0 } [ $OS = Linux ] && complete -F _rmmod rmmod # Linux insmod(8) & modprobe(8) completion. This completes on a list of all # available modules for the version of the kernel currently running. # [ $OS = Linux ] && _insmod() { local cur prev modpath COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} modpath=/lib/modules/`uname -r` # behave like lsmod for modprobe -r if [ $1 = "modprobe" ] && [ "${COMP_WORDS[1]}" = "-r" ]; then COMPREPLY=( $( /sbin/lsmod | \ awk '{if (NR != 1 && $1 ~ /^'$cur'/) print $1}' ) ) return 0 fi # do filename completion if we're giving a path to a module if [[ "$cur" == /* ]]; then _filedir return 0 fi if [ $COMP_CWORD -gt 1 ]; then # do module parameter completion COMPREPLY=( $( /sbin/modinfo -p ${COMP_WORDS[1]} 2>/dev/null | \ awk '{if ($1 ~ /^parm:/ && $2 ~ /^'$cur'/) { print $2 } \ else if ($1 !~ /:/ && $1 ~ /^'$cur'/) { print $1 }}' ) ) elif [ -r $modpath -a -x $modpath ]; then # do module name completion COMPREPLY=( $( \ls -R $modpath | \ sed -ne 's/^\('$cur'.*\)\.o\(\|.gz\)$/\1/p') ) else _filedir fi return 0 } [ $OS = Linux ] && complete -F _insmod $filenames insmod modprobe # man(1) completion. This is Linux and Darwin specific, in that # 'man
' is the expected syntax. # [ $OS = Linux -o $OS = Darwin ] && _man() { local cur prev sect manpath OS COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} _expand || return 0 # default completion if parameter contains / if [[ "$cur" == */* ]]; then _filedir return 0 fi OS=$( uname -s ) if [ $OS = Linux ]; then manpath=$( manpath 2>/dev/null || man --path ) else manpath=$MANPATH fi if [ -z "$manpath" ]; then COMPREPLY=( $( compgen -c -- $cur ) ) return 0 fi # determine manual section to search [[ "$prev" == [0-9ln] ]] && sect=$prev || sect='?' manpath=$manpath: if [ -n "$cur" ]; then manpath="${manpath//://man$sect/$cur* }" else manpath="${manpath//://man$sect/ }" fi # redirect stderr for when path doesn't exist COMPREPLY=( $( eval \\ls "$manpath" 2>/dev/null ) ) # weed out directory path names and paths to man pages COMPREPLY=( ${COMPREPLY[@]##*/?(:)} ) # strip suffix from man pages COMPREPLY=( ${COMPREPLY[@]%.@(gz|bz2)} ) COMPREPLY=( ${COMPREPLY[@]%.*} ) if [[ "$prev" != [0-9ln] ]]; then COMPREPLY=( ${COMPREPLY[@]} $( compgen -d -- $cur ) \ $( compgen -f -X '!*.[0-9ln]' -- $cur ) ) fi return 0 } [ $OS = Linux -o $OS = Darwin ] && complete -F _man $filenames man # renice(8) completion # _reniz{|}~ce() { local command cur curopt i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} command=$1 i=0 # walk back throuh command line and find last option while [ $i -le $COMP_CWORD -a ${#COMPREPLY[@]} -eq 0 ]; do curopt=${COMP_WORDS[COMP_CWORD-$i]} case "$curopt" in -u) COMPREPLY=( $( compgen -u -- $cur ) ) ;; -g) _pgids ;; -p|$command) _pids ;; esac i=$(( ++i )) done } complete -F _renice renice # kill(1) completion # _kill() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD -eq 1 ] && [[ "$cur" == -* ]]; then # return list of available signals _signals else # return list of available PIDs _pids fi } complete -F _kill kill # Linux and FreeBSD killall(1) completion. # [ $OS = Linux -o $OS = FreeBSD ] && _killall() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD -eq 1 ] && [[ "$cur" == -* ]]; then _signals else COMPREPLY=( $( compgen -W '$( ps axo ucomm | sed 1d )' \ -- $cur ) ) fi return 0 } [ $OS = Linux -o $OS = FreeBSD ] && complete -F _killall killall # GNU find(1) completion. This makes heavy use of ksh style extended # globs and contains Linux specific code for completing the parameter # to the -fstype option. # _find() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -@(max|min)depth) COMPREPLY=( $( compgen -W '0 1 2 3 4 5 6 7 8 9' -- $cur ) ) return 0 ;; -?(a)newer|-fls|-fprint?(0|f)|-?(i)?(l)name) _filedir return 0 ;; -fstype) # this is highly non-portable COMPREPLY=( $( cut -d$'\t' -f 2 /proc/filesystems | \ grep "^$cur" ) ) return 0 ;; -gid) COMPREPLY=( $( awk 'BEGIN {FS=":"} \ {if ($3 ~ /^'$ncur'/) print $3}' /etc/group ) ) return 0 ;; -group) [ ${BASH_VERSINFO[1]} '>' 04 ] && \ COMPREPLY=( $( compgen -g -- $cur ) ) return 0 ;; -?(x)type) COMPREPLY=( $( compgen -W 'b c d p f l s' -- $cur ) ) return 0 ;; -uid) COMPREPLY=( $( awk 'BEGIN {FS=":"} \ {if ($3 ~ /^'$ncur'/) print $3}' /etc/passwd ) ) return 0 ;; -user) COMPREPLY=( $( compgen -u -- $cur ) ) return 0 ;; -[acm]min|-[acm]time|-?(i)?(l)name|-inum|-?(i)path|-?(i)regex| \ -links|-perm|-size|-used|-exec|-ok|-printf) # do nothing, just wait for a parameter to be given return 0 ;; esac _expand || return 0 # handle case where first parameter is not a dash option if [ $COMP_CWORD -eq 1 ] && [[ "$cur" != -* ]]; then _filedir -d return 0 fi # complete using basic options COMPREPLY=( $( compgen -W '-daystart -depth -follow -help -maxdepth \ -mindepth -mount -noleaf -version -xdev -amin -anewer \ -atime -cmin -cnewer -ctime -empty -false -fstype \ -gid -group -ilname -iname -inum -ipath -iregex \ -links -lname -mmin -mtime -name -newer -nouser \ -nogroup -perm -regex -size -true -type -uid -used \ -user -xtype -exec -fls -fprint -fprint0 -fprintf -ok \ -print -print0 -printf -prune -ls' -- $cur ) ) # this removes any options from the list of completions that have # already been specified somewhere on the command line. COMPREPLY=( $( echo "${COMP_WORDS[@]}" | \ (while read -d ' ' i; do [ "$i" == "" ] && continue # flatten array with spaces on either side, # otherwise we cannot grep on word boundaries of # first and last word COMPREPLY=" ${COMPREPLY[@]} " # remove word from list of completions COMPREPLY=( ${COMPREPLY/ ${i%% *} / } ) done echo ${COMPREPLY[@]}) ) ) return 0 } complete -F _find $filenames find # Linux ifconfig(8) completion # [ $OS = Linux ] && _ifconfig() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} case "${COMP_WORDS[1]}" in -|*[0-9]*) COMPREPLY=( $( compgen -W '-a up down arp promisc allmulti \ metric mtu dstaddr netmask add del \ tunnel irq io_addr mem_start media \ broadcast pointopoint hw multicast \ address txqueuelen' $cur )) COMPREPLY=( $( echo " ${COMP_WORDS[@]}" | \ (while read -d ' ' i; do [ "$i" == "" ] && continue # flatten array with spaces on either side, # otherwise we cannot grep on word # boundaries of first and last word COMPREPLY=" ${COMPREPLY[@]} " # remove word from list of completions COMPREPLY=( ${COMPREPLY/ $i / } ) done echo ${COMPREPLY[@]}) ) ) return 0 ;; esac COMPREPLY=( $( /sbin/ifconfig -a | \ sed -ne 's|^\('$cur'[^ ]*\).*$|\1|p' )) } [ $OS = Linux ] && complete -F _ifconfig ifconfig # RedHat & Debian Linux if{up,down} completion # [ $OS = Linux ] && ( have ifup || have ifdown ) && _ifupdown() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD -eq 1 ]; then if [ -f /etc/debian_version ]; then # Debian system COMPREPLY=( $( sed -ne 's|^iface \([^ ]\+\).*$|\1|p' \ /etc/network/interfaces ) ) else # Assume Red Hat COMPREPLY=( $( \ls /etc/sysconfig/network-scripts/ifcfg-* | sed -ne 's|.*ifcfg-\('$cur'.*\)|\1|p' ) ) fi fi return 0 } [ $OS = Linux ] && have ifup && complete -F _ifupdown ifup ifdown # Linux ipsec(8) completion (for FreeS/WAN). Basic. # [ $OS = Linux ] && have ipsec && _ipsec() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD -eq 1 ]; then COMPREPLY=( $( compgen -W 'auto barf eroute klipsdebug look \ manual pluto ranbits rsasigkey \ setup showdefaults showhostkey spi \ spigrp tncfg whack' $cur ) ) return 0 fi case ${COMP_WORDS[1]} in auto) COMPREPLY=( $( compgen -W '--asynchronous --up --add --delete \ --replace --down --route --unroute \ --ready --status --rereadsecrets' \ $cur ) ) ;; manual) COMPREPLY=( $( compgen -W '--up --down --route --unroute \ --union' $cur ) ) ;; ranbits) COMPREPLY=( $( compgen -W '--quick --continuous --bytes' $cur ) ) ;; setup) COMPREPLY=( $( compgen -W '--start --stop --restart' $cur ) ) ;; *) ;; esac return 0 } [ $OS = Linux ] && [ "$have" ] && complete -F _ipsec ipsec # cvs(1) completion # have cvs && _cvs() { set_prefix() { [ -z "$prefix" ] || prefix=${cur%/*}/ [ -r ${prefix}CVS/Entries ] || prefix="" } get_entries() { entries=( $( cut -d/ -f2 -s ${prefix}CVS/Entries | \ grep "^$cur" ) ) } get_modules() { if [ -n "$prefix" ]; then COMPREPLY=( $( \ls -d ${cvsroot}/${prefix}/!(CVSROOT) )) else COMPREPLY=( $( \ls -d ${cvsroot}/!(CVSROOT) ) ) fi } local cur count mode i cvsroot pwd local -a flags miss files entries changed newremoved COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} count=1 for i in ${COMP_WORDS[@]}; do [ $count -eq $COMP_CWORD ] && break if [ -z "$mode" ]; then case $i in -d) cvsroot=${COMP_WORDS[((++count))]} ;; @(add|new)) mode=add ;; @(admin|rcs)) mode=admin ;; @(checkout|co|get)) mode=checkout ;; @(commit|ci)) mode=commit ;; @(diff|@(ex|im)port|history|release|status|update)) mode=$i ;; ?(r)log) mode=log ;; @(rdiff|patch)) mode=rdiff ;; @(remove|rm|delete)) mode=remove ;; @(rtag|rfreeze)) mode=rtag ;; @(tag|freeze)) mode=tag ;; *) ;; esac continue elif [[ "$i" = -* ]]; then flags=( ${flags[@]} $i ) fi count=$((++count)) done case "$mode" in add) if [[ "$cur" != -* ]]; then set_prefix if [ $COMP_CWORD -gt 1 -a -r ${prefix}CVS/Entries ]; then get_entries [ -z "$cur" ] && \ files=$( \ls -A | grep -v '^CVS$' ) || \ files=$( \ls -d ${cur}* ) for i in ${entries[@]}; do files=( ${files[@]%$i} ) done COMPREPLY=( $( compgen -W '${files[@]}' -- \ $cur ) ) fi else COMPREPLY=( $( compgen -W '-k -m' -- $cur ) ) fi ;; admin) if [[ "$cur" = -* ]]; then COMPREPLY=( $( compgen -W '-i -a -A -e -b -c -k -l -u \ -L -U -m -M -n -N -o -q -I \ -s -t -t- -T -V -x -z' -- \ $cur ) ) fi ;; checkout) if [[ "$cur" != -* ]]; then # can only do for local repositories [ -z "$cvsroot" ] && cvsroot=$CVSROOT prefix=${cur%/*} [ -r ${cvsroot}/${prefix} ] || prefix="" if [ -r ${cvsroot}/${prefix} ]; then get_modules COMPREPLY=( ${COMPREPLY[@]#$cvsroot} ) COMPREPLY=( ${COMPREPLY[@]#/} ) COMPREPLY=( $( compgen -W \ '${COMPREPLY[@]}' -- $cur ) ) fi else COMPREPLY=( $( compgen -W '-A -N -P -R -c -f -l -n -p \ -s -r -D -d -k -j' -- $cur ) ) fi ;; commit) set_prefix if [[ "$cur" != -* ]] && [ -r ${prefix}CVS/Entries ]; then # if $COMP_CVS_REMOTE is not null, 'cvs commit' will # complete on remotely checked-out files (requires # passwordless access to the remote repository if [ -n "$COMP_CVS_REMOTE" ]; then # this is the least computationally intensive # way found so far, but other changes # (something other than changed/removed/new) # may be missing changed=( $( cvs diff --brief 2>&1 | \ sed -ne 's/^Files [^ ]* and \([^ ]*\) differ$/\1/p' ) ) newremoved=( $( cvs diff --brief 2>&1 | \ sed -ne 's/^cvs diff: \([^ ]*\) .*, no comparison available$/\1/p' ) ) COMPREPLY=( $( compgen -W '${changed[@]} \ ${newremoved[@]}' -- $cur ) ) else COMPREPLY=( $( compgen -f -- $cur ) ) fi else COMPREPLY=( $( compgen -W '-n -R -l -f -F -m -r' -- \ $cur ) ) fi ;; remove) if [[ "$cur" != -* ]]; then set_prefix if [ $COMP_CWORD -gt 1 -a -r ${prefix}CVS/Entries ]; then get_entries # find out what files are missing for i in ${entries[@]}; do [ ! -r "$i" ] && miss=( ${miss[@]} $i ) done COMPREPLY=( $(compgen -W '${miss[@]}' -- $cur) ) fi else COMPREPLY=( $( compgen -W '-f -l -R' -- $cur ) ) fi ;; import) if [[ "$cur" != -* ]]; then # starts with same algorithm as checkout [ -z "$cvsroot" ] && cvsroot=$CVSROOT prefix=${cur%/*} if [ -r ${cvsroot}/${prefix} ]; then get_modules COMPREPLY=( ${COMPREPLY[@]#$cvsroot} ) COMPREPLY=( ${COMPREPLY[@]#\/} ) fi pwd=$( pwd ) pwd=${pwd##*/} COMPREPLY=( $( compgen -W '${COMPREPLY[@]} $pwd' -- \ $cur ) ) else COMPREPLY=( $( compgen -W '-d -k -I -b -m -W' -- $cur )) fi ;; "") COMPREPLY=( $( compgen -W 'add admin checkout ci co commit \ diff delete export freeze get \ history import log new patch rcs \ rdiff release remove rfreeze rlog \ rm rtag status tag update -H -Q -q \ -b -d -e -f -l -n -t -r -v -w -x \ -z --help --version' -- $cur ) ) ;; *) ;; esac return 0 } [ "$have" ] && complete -F _cvs $default cvs have rpm && # helper functions for rpm completion # rpm_installed_packages() { if [ -r /var/log/rpmpkgs -a \ /var/log/rpmpkgs -nt /var/lib/rpm/Packages ]; then # using RHL 7.2 - this is quicker than querying the DB COMPREPLY=( $( sed -ne \ 's|^\('$cur'.*\)-[0-9a-zA-Z._]\+-[0-9a-z.]\+.*\.rpm$|\1|p' \ /var/log/rpmpkgs ) ) else COMPREPLY=( $( rpm -qa | sed -ne \ 's|^\('$cur'.*\)-[0-9a-zA-Z._]\+-[0-9a-z.]\+$|\1|p' ) ) fi } file_glob() { _expand || return 0 COMPREPLY=( $( compgen -f -X "!*.$1" -- $cur ) \ $( compgen -d -- $cur ) ) } # rpm(8) completion # _rpm() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} if [ $COMP_CWORD -eq 1 ]; then # first parameter on line case "$cur" in -b*) COMPREPLY=( $( compgen -W '-ba -bb -bc -bi -bl -bp -bs'\ -- $cur ) ) ;; -t*) COMPREPLY=( $( compgen -W '-ta -tb -tc -ti -tl -tp -ts'\ -- $cur ) ) ;; --*) COMPREPLY=( $( compgen -W '--help --version --initdb \ --checksig --recompile --rebuild --resign --addsign \ --rebuilddb --showrc --setperms --setugids --tarbuild \ --eval --install --upgrade --query --freshen --erase \ --verify --querytags --rmsource --rmspec --clean' -- \ $cur ) ) ;; *) COMPREPLY=( $( compgen -W '-b -e -F -i -q -t -U -V' \ -- $cur ) ) ;; esac return 0 fi case "$prev" in --@(@(db|exclude)path|prefix|relocate|root)) _filedir -d return 0 ;; --eval) # get a list of macros COMPREPLY=( $( sed -ne 's|^\(%'${cur#\%}'[^ '$'\t'']*\).*$|\1|p' \ /usr/lib/rpm/macros ) ) return 0 ;; --pipe) COMPREPLY=( $( compgen -c -- $cur ) ) return 0 ;; --rcfile) _filedir return 0 ;; --specfile) # complete on .spec files file_glob spec return 0 ;; --whatprovides) if [[ "$cur" == */* ]]; then _filedir else # complete on capabilities COMPREPLY=( $( rpm -qa --queryformat \ '%{providename}\n' | grep "^$cur" ) ) fi return 0 ;; --whatrequires) # complete on capabilities COMPREPLY=( $( rpm -qa --queryformat '%{requirename}\n' | \ grep "^$cur" ) ) return 0 ;; esac case "${COMP_WORDS[1]}" in -@([iFU]*|-install|-freshen|-upgrade)) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--percent --force --test \ --replacepkgs --replacefiles --root --excludedocs \ --includedocs --noscripts --rcfile --ignorearch \ --dbpath --prefix --ignoreos --nodeps --allfiles \ --ftpproxy --ftpport --justdb --httpproxy --httpport \ --noorder --relocate --badreloc --notriggers \ --excludepath --ignoresize --oldpackage --define \ --eval --pipe --queryformat --repackage' -- $cur ) ) else file_glob rpm fi ;; -*f) _filedir ;; -@(e|-erase)) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--allmatches --noscripts \ --notriggers --nodeps --test --repackage' -- $cur ) ) else rpm_installed_packages fi ;; -@(q*|-query)) # check whether we're doing package group completion if [ "${COMP_LINE#* -*([^ -])g}" != "$COMP_LINE" ]; then local IFS=$'\t' # remove trailing backslash, or grep will complain cur=${cur%'\'} COMPREPLY=( $( rpm -qa --queryformat '%{group}\n' | \ grep "^$cur" ) ) # backslash escape spaces and translate newlines to tabs COMPREPLY=( $( echo ${COMPREPLY[@]} | sed 's/ /\\ /g' |\ tr '\n' '\t' ) ) elif [ "${COMP_LINE#* -*([^ -])p}" != "$COMP_LINE" ]; then # uninstalled package completion if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--scripts --root \ --rcfile --whatprovides --whatrequires \ --requires --triggeredby --ftpport --ftpproxy \ --httpproxy --httpport --provides --triggers \ --dump --changelog --dbpath --filesbypkg \ --define --eval --pipe --showrc --info --list \ --state --docfiles --configfiles --queryformat \ --conflicts --obsoletes' -- $cur ) ) else file_glob rpm fi else # installed package completion if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--scripts --root \ --rcfile --whatprovides --whatrequires \ --requires --triggeredby --ftpport --ftpproxy \ --httpproxy --httpport --provides --triggers \ --dump --changelog --dbpath --specfile \ --querybynumber --last --filesbypkg --define \ --eval --pipe --showrc --info --list --state \ --docfiles --configfiles --queryformat \ --conflicts --obsoletes --pkgid --hdrid \ --fileid --tid' -- $cur ) ) elif [ "${COMP_LINE#* -*([^ -])a}" == "$COMP_LINE" ]; then rpm_installed_packages fi fi ;; -@(K|-checksig)) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--nopgp --nogpg --nomd5' \ -- $cur ) ) else file_glob rpm fi ;; -@([Vy]*|-verify)) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--root --rcfile --dbpath \ --nodeps --nofiles --noscripts --nomd5 --querytags \ --specfile --whatrequires --whatprovides' -- $cur ) ) elif [ "${COMP_LINE#* -*([^ -])p}" != "$COMP_LINE" ]; then file_glob rpm else rpm_installed_packages fi ;; -[bt]*) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--short-circuit --timecheck \ --clean --rmsource --rmspec --test --sign --buildroot \ --targetbuildarch --buildos --nobuild --nodeps \ --nodirtokens' -- $cur ) ) elif [[ ${COMP_WORDS[1]} == -b* ]]; then file_glob spec else file_glob '@(tgz|tar.@(gz|bz2))' fi ;; --re@(build|compile)) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--nodeps --rmsource \ --rmspec --sign --nodirtokens' -- $cur ) ) else file_glob src.rpm fi ;; --tarbuild) file_glob '@(tgz|tar.@(gz|bz2))' ;; --@(re|add)sign) file_glob rpm ;; --set@(perms|gids)) rpm_installed_packages ;; --@(clean|rms@(ource|pec))) if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '--clean --rmsource \ --rmspec' -- $cur ) ) else file_glob spec fi ;; esac return 0 } [ "$have" ] && complete -F _rpm $filenames rpm # Debian Linux apt-get(8) completion. # have apt-get && _apt_get() { local cur prev special i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} for (( i=0; i < ${#COMP_WORDS}-1; i++ )); do if [[ ${COMP_WORDS[i]} == @(install|remove|source|build-dep) ]]; then special=${COMP_WORDS[i]} fi done if [ -n "$special" ]; then case $special in @(install|source|build-dep)) COMPREPLY=( $( apt-cache pkgnames $cur ) ) return 0 ;; remove) if [ -f /etc/debian_version ]; then # Debian system COMPREPLY=( $( _comp-dpkg-installed-packages \ $cur ) ) else # assume RPM based rpm_installed_packages fi return 0 ;; esac fi if [[ "$prev" == -*c ]] || [ "$prev" = --config-file ]; then _filedir else COMPREPLY=( $( compgen -W 'update upgrade dselect-upgrade \ dist-upgrade install remove source \ build-dep check \ clean autoclean -d -f -h -v -m -q -s -y -u \ -b -c -o --download-only --fix-broken --help \ --version --ignore-missing --fix-missing \ --no-download --quiet --simulate \ --just-print --dry-run --recon --no-act \ --yes --assume-yes --show-upgraded \ --compile --build --ignore-hold \ --no-upgrade --force-yes --print-uris \ --purge --reinstall --list-cleanup \ --trivial-only --no-remove --diff-only \ --tar-only --config-file --option' -- $cur ) ) fi return 0 } [ "$have" ] && complete -F _apt_get $filenames apt-get # Debian Linux apt-cache(8) completion. # have apt-cache && _apt_cache() { local cur prev special i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} for (( i=0; i < ${#COMP_WORDS}-1; i++ )); do if [[ ${COMP_WORDS[i]} == @(add|show?(pkg)|depends|dotty) ]]; then special=${COMP_WORDS[i]} fi done if [ -n "$special" ]; then case $special in add) _filedir return 0 ;; show?(pkg)|depends|dotty) COMPREPLY=( $( apt-cache pkgnames $cur ) ) return 0 ;; esac fi if [[ "$prev" == -*c ]] || [ "$prev" = --config-file ]; then _filedir else COMPREPLY=( $( compgen -W 'add gencaches showpkg stats dump \ dumpavail unmet check search show dotty \ depends pkgnames -h -v -p -s -q -i -f -a -g -c \ -o --help --version --pkg-cache --src-cache \ --quiet --important --full --all-versions \ --no-generate --names-only --all-names \ --config-file --option' -- $cur ) ) fi return 0 } [ "$have" ] && complete -F _apt-cache $filenames apt-cache complete -F _apt_cache $filenames apt-cache # chsh(1) completion # _chsh() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} if [ "$prev" = "-s" ]; then COMPREPLY=( $( chsh -l | grep "^$cur" ) ) else COMPREPLY=( $( compgen -u -- $cur ) ) fi return 0 } complete -F _chsh chsh # chkconfig(8) completion # have chkconfig && _chkconfig() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} if [ $COMP_CWORD -eq 1 ]; then COMPREPLY=( $( compgen -W '--list --add --del --level' -- \ $cur ) ) return 0 fi if [ $COMP_CWORD -eq 4 ]; then COMPREPLY=( $( compgen -W 'on off reset' -- $cur ) ) return 0 fi case "$prev" in @([1-6]|--@(list|add|del))) COMPREPLY=( $( compgen -W "`(cd /etc/rc.d/init.d; echo *)`" \ -- $cur) ) return 0 ;; --level) COMPREPLY=( $( compgen -W '1 2 3 4 5 6' -- $cur ) ) return 0 ;; esac return 0 } [ "$have" ] && complete -F _chkconfig chkconfig # This function performs host completion based on ssh's known_hosts files, # defaulting to standard host completion if they don't exist. # _known_hosts() { local cur user suffix local -a kh COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} [ "$1" = -c ] && suffix=':' [[ $cur == *@* ]] && user=${cur%@*}@ && cur=${cur#*@} kh=() [ -r /etc/known_hosts ] && kh[0]=/etc/known_hosts [ -r /etc/known_hosts2 ] && kh[1]=/etc/known_hosts2 [ -r ~/.ssh/known_hosts ] && kh[2]=~/.ssh/known_hosts [ -r ~/.ssh/known_hosts2 ] && kh[3]=~/.ssh/known_hosts2 # If we have known_hosts files to use if [ ${#kh[@]} -gt 0 ]; then # Escape slashes and dots in paths for awk cur=${cur//\//\\\/} cur=${cur//\./\\\.} if [[ "$cur" == [0-9]*.* ]]; then # Digits followed by a dot - just search for that cur="^$cur.*" elif [[ "$cur" == [0-9]* ]]; then # Digits followed by no dot - search for digits followed # by a dot cur="^$cur.*\." elif [ -z "$cur" ]; then # A blank - search for a dot or an alpha character cur="[a-z.]" else cur="^$cur" fi # FS needs to look for a comma separated list COMPREPLY=( $( awk 'BEGIN {FS=","} {for (i=1; i<=2; ++i) { \ gsub(" .*$", "", $i); \ if ($i ~ /'$cur'/) {print $i} \ }}' ${kh[@]} ) ) for (( i=0; i < ${#COMPREPLY[@]}; i++ )); do COMPREPLY[i]=$user${COMPREPLY[i]}$suffix done else # Just do normal hostname completion COMPREPLY=( $( compgen -A hostname -S "$suffix" -- $cur ) ) fi return 0 } complete -F _known_hosts traceroute ping fping telnet host nslookup rsh \ rlogin ftp # ssh(1) completion # have ssh && _ssh() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -*c) COMPREPLY=( $( compgen -W 'blowfish 3des 3des-cbc blowfish-cbc \ arcfour cast128-cbc' -- $cur ) ) ;; -*l) COMPREPLY=( $( compgen -u -- $cur ) ) ;; *) _known_hosts [ $COMP_CWORD -eq 1 ] || \ COMPREPLY=( ${COMPREPLY[@]} $( compgen -c -- $cur ) ) esac return 0 } [ "$have" ] && shopt -u hostcomplete && complete -F _ssh ssh slogin sftp # scp(1) completion # have scp && _scp() { local cur userhost path COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} _expand || return 0 if [[ "$cur" == *:* ]]; then # remove backslash escape from : cur=${cur/\\:/:} userhost=${cur%%?(\\):*} path=${cur#*:} if [ -z "$path" ]; then # default to home dir of specified user on remote host path=$( ssh -o 'Batchmode yes' $userhost pwd ) fi COMPREPLY=( $( compgen -P "$userhost:" \ -W "`echo $( ssh -o 'Batchmode yes' $userhost \ compgen -f -- $path 2>/dev/null)`")) return 0 fi [[ "$cur" == */* ]] || _known_hosts -c _filedir return 0 } [ "$have" ] && complete $filenames -F _scp scp # Linux route(8) completion # [ $OS = Linux ] && _route() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} if [ "$prev" = dev ]; then COMPREPLY=( $( ifconfig -a | sed -ne 's|^\('$cur'[^ ]*\).*$|\1|p' )) return 0 fi COMPREPLY=( $( compgen -W 'add del -host -net netmask metric mss \ window irtt reject mod dyn reinstate dev \ default gw' -- $cur ) ) COMPREPLY=( $( echo " ${COMP_WORDS[@]}" | \ (while read -d ' ' i; do [ "$i" == "" ] && continue # flatten array with spaces on either side, # otherwise we cannot grep on word # boundaries of first and last word COMPREPLY=" ${COMPREPLY[@]} " # remove word from list of completions COMPREPLY=( ${COMPREPLY/ $i / } ) done echo ${COMPREPLY[@]}) ) ) return 0 } [ $OS = Linux ] && complete -F _route route # GNU make(1) completion (adapted from the example supplied with the bash 2.04 # source code) # have make && _make() { local mdef makef gcmd cur prev i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} # if prev argument is -f, return possible filename completions. # we could be a little smarter here and return matches against # `makefile Makefile *.mk', whatever exists if [[ "$prev" == -*f ]]; then _filedir return 0 fi # check for a long option if [[ "$cur" == --* ]]; then _longopt $1 return 0 fi # if we want an option, return the possible posix options if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '-e -f -i -k -n -p -q -r -S -s -t' \ -- $cur ) ) return 0 fi # make reads `makefile' before `Makefile' if [ -f makefile ]; then mdef=makefile elif [ -f Makefile ]; then mdef=Makefile else mdef=*.mk # local convention fi # before we scan for targets, see if a makefile name was specified # with -f for (( i=0; i < ${#COMP_WORDS[@]}; i++ )); do if [[ ${COMP_WORDS[i]} == -*f ]]; then eval makef=${COMP_WORDS[i+1]} # eval for tilde expansion break fi done [ -z "$makef" ] && makef=$mdef # if we have a partial word to complete, restrict completions to # matches of that word [ -n "$2" ] && gcmd='grep "^$2"' || gcmd=cat # if we don't want to use *.mk, we can take out the cat and use # test -f $makef and input redirection COMPREPLY=( $( cat $makef 2>/dev/null | \ awk 'BEGIN {FS=":"} /^[^.# ][^=]*:/ {print $1}' | \ eval $gcmd ) ) # default to filename completion if all else failed [ ${#COMPREPLY[@]} -eq 0 ] && _filedir return 0 } [ "$have" ] && complete -F _make -X '+($*|*.[cho])' $filenames make gmake pmake # Red Hat Linux service completion. This completes on a list of all available # service scripts in the SysV init.d directory, followed by that script's # available commands # have service && _service() { local cur sysvdir COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} [ -d /etc/rc.d/init.d ] && sysvdir=/etc/rc.d/init.d \ || sysvdir=/etc/init.d #[[ "$cur" == -* ]] && return 0 if [ $COMP_CWORD -eq 1 ]; then COMPREPLY=( $( compgen -W '`echo $sysvdir/!(*.rpmsave|*.rpmorig)`' ) ) COMPREPLY=( $( compgen -W '${COMPREPLY[@]#$sysvdir/}' -- \ $cur ) ) else COMPREPLY=( $( compgen -W '`sed -ne "y/|/ /; \ s/^.*Usage.*{\(.*\)}.*$/\1/p" \ $sysvdir/${COMP_WORDS[1]}`' -- \ $cur ) ) fi return 0 } [ "$have" ] && complete -F _service service # GNU tar(1) completion # _tar() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD = 1 ]; then COMPREPLY=( $( compgen -W 'c t x u r d A' -- $cur ) ) return 0 fi case "${COMP_WORDS[1]}" in c*f) _filedir ;; +([^Izjy])f) COMPREPLY=( $( compgen -d -- $cur ) \ $( compgen -f -X '!*.tar' -- $cur ) ) ;; *z*f) COMPREPLY=( $( compgen -d -- $cur ) \ $( compgen -f -X '!*.t?(ar.)gz' -- $cur ) ) ;; *[Ijy]*f) COMPREPLY=( $( compgen -d -- $cur ) \ $( compgen -f -X '!*.tar.bz2' -- $cur ) ) ;; *) _filedir ;; esac return 0 } complete -F _tar $filenames tar # jar(1) completion # have jar && _jar() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD = 1 ]; then COMPREPLY=( $( compgen -W 'c t x u' -- $cur ) ) return 0 fi case "${COMP_WORDS[1]}" in c*f) _filedir ;; *f) COMPREPLY=( $( compgen -d -- $cur ) \ $( compgen -f -X '!*.jar' -- $cur ) ) ;; *) _filedir ;; esac } [ "$have" ] && complete -F _jar $filenames jar # Linux iptables(8) completion # have iptables && _iptables() { local cur prev table chain COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} chain='s/^Chain \([^ ]\+\).*$/\1/p' if [[ $COMP_LINE == *-t\ *filter* ]]; then table="-t filter" elif [[ $COMP_LINE == *-t\ *nat* ]]; then table="-t nat" elif [[ $COMP_LINE == *-t\ *mangle* ]]; then table="-t mangle" fi case "$prev" in -*[AIDPFXL]) COMPREPLY=( $( compgen -W '`iptables $table -nL | \ sed -ne "s/^Chain \([^ ]\+\).*$/\1/p"`' -- $cur ) ) ;; -*t) COMPREPLY=( $( compgen -W 'nat filter mangle' -- $cur ) ) ;; -j) if [ "$table" = "-t filter" -o "$table" = "" ]; then COMPREPLY=( $( compgen -W 'ACCEPT DROP LOG ULOG REJECT \ `iptables $table -nL | sed -ne "$chain" \ -e "s/INPUT|OUTPUT|FORWARD|PREROUTING|POSTROUTING//"`' -- \ $cur ) ) elif [ "$table" = "-t nat" ]; then COMPREPLY=( $( compgen -W 'ACCEPT DROP LOG ULOG REJECT \ MIRROR SNAT DNAT MASQUERADE `iptables $table -nL | \ sed -ne "$chain" -e "s/OUTPUT|PREROUTING|POSTROUTING//"`' \ -- $cur ) ) elif [ "$table" = "-t mangle" ]; then COMPREPLY=( $( compgen -W 'ACCEPT DROP LOG ULOG REJECT \ MARK TOS `iptables $table -nL | sed -ne "$chain" \ -e "s/INPUT|OUTPUT|FORWARD|PREROUTING|POSTROUTING//"`' -- \ $cur ) ) fi ;; *) ;; esac } [ "$have" ] && complete -F _iptables iptables # tcpdump(8) completion # have tcpdump && _tcpdump() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} COMPREPLY=( $( compgen -W 'host net port src dst ether gateway \ less greater' -- $cur ) ) } [ "$have" ] && complete -F _tcpdump tcpdump # autorpm(8) completion # have autorpm && _autorpm() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} COMPREPLY=( $( compgen -W '--notty --debug --help --version \ auto add fullinfo info help install list \ remove set' -- $cur ) ) } [ "$have" ] && complete -F _autorpm autorpm # This meta-cd function observes the CDPATH variable, so that cd additionally # completes on directories under those specified in CDPATH. # _cd() { local IFS=$'\t\n' cur=${COMP_WORDS[COMP_CWORD]} dirs=() i _expand || return 0 # Use standard dir completion if no CDPATH or parameter starts with /, # ./ or ../ if [ -z "$CDPATH" ] || [[ "$cur" == ?(.)?(.)/* ]]; then _filedir -d return 0 fi IFS=$'\t' # we have a CDPATH, so loop on its contents for i in ${CDPATH//:/$'\t'}; do # create an array of matched subdirs dirs=( $( compgen -d $i/$cur ) ) # add subdirs to list of completions as necessary [ ${#dirs[@]} ] && COMPREPLY=( ${COMPREPLY[@]} ${dirs[@]#$i/}) done _filedir -d IFS=$' \t\n' if [ -n "$CDPATH" ]; then for (( i=0; i < ${#COMPREPLY[@]}; i++ )); do # remove leading ./ from completions COMPREPLY[i]=${COMPREPLY[i]#.\/} # turn relative paths from current dir into # absolute ones [ -d ./"${COMPREPLY[i]}" ] && \ COMPREPLY[i]=$PWD/${COMPREPLY[i]} done fi return 0 } complete -F _cd $nospace $filenames cd # A meta-command completion function for commands like sudo(8), which need to # first complete on a command, then complete according to that command's own # completion definition - currently not quite foolproof (e.g. mount and umount # don't work properly), but still quite useful # _command() { local cur func cline cspec COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD -eq 1 ]; then COMPREPLY=( $( compgen -c -- $cur ) ) elif complete -p ${COMP_WORDS[1]} &>/dev/null; then cspec=$( complete -p ${COMP_WORDS[1]} ) if [ "${cspec#*-F }" != "$cspec" ]; then # complete -F # # COMP_CWORD and COMP_WORDS() are not read-only, # so we can set them before handing off to regular # completion routine # get function name func=${cspec#*-F } func=${func%% *} # get current command line minus initial command cline="${COMP_LINE#$1 }" # split current command line tokens into array COMP_WORDS=( $cline ) # set current token number to 1 less than expanded line COMP_CWORD=$(( ${#COMP_WORDS[@]} - 1 )) cur=${COMP_WORDS[COMP_CWORD]} $func $cline # remove any \: generated by a command that doesn't # default to filenames or dirnames (e.g. sudo chown) if [ "${cspec#*-o }" != "$cspec" ]; then cspec=${cspec#*-o } cspec=${cspec%% *} if [[ "$cspec" != @(dir|file)names ]]; then COMPREPLY=( "${COMPREPLY[@]//\\\\:/:}" ) fi fi elif [ "${cspec#*-[abcdefgjkvu]}" != "$cspec" ]; then # complete -[abcdefgjkvu] func=$( echo $cspec | \ sed -e 's/^.*\(-[abcdefgjkvu]\).*$/\1/' ) COMPREPLY=( $( compgen $func -- $cur ) ) elif [ "${cspec#*-A}" != "$cspec" ]; then # complete -A func=${cspec#*-A } func=${func%% *} COMPREPLY=( $( compgen -A $func -- $cur ) ) fi fi [ ${#COMPREPLY[@]} -eq 0 ] && _filedir } complete -F _command $filenames nohup exec nice eval strace time _root_command() { PATH=$PATH:/sbin:/usr/sbin:/usr/local/sbin _command $1 } complete -F _root_command $filenames sudo fakeroot # ant(1) completion # have ant && _ant() { local cur prev buildfile i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -buildfile) COMPREPLY=( $( compgen -f -X '!*.xml' -- $cur ) \ $( compgen -d -- $cur ) ) return 0 ;; -logfile) _filedir return 0 ;; esac if [[ "$cur" == -* ]]; then # relevant options completion COMPREPLY=( $( compgen -W '-help -projecthelp -version -quiet \ -verbose -debug -emacs -logfile -logger \ -listener -buildfile -D -find' -- $cur ) ) else # available targets completion # find wich buildfile to use buildfile=build.xml for (( i=1; i < COMP_CWORD; i++ )); do if [[ "${COMP_WORDS[i]}" == -buildfile ]]; then buildfile=${COMP_WORDS[i+1]} break fi done [ ! -f $buildfile ] && return 0 # parse buildfile for targets COMPREPLY=( $( awk -F'"' '//dev/null | grep "^ $cur" ) ) [ ${#COMPREPLY[@]} -eq 0 ] && \ COMPREPLY=( $( compgen -u -- $cur ) ) return 0 ;; *) COMPREPLY=( $( psql -l | sed -ne 's|^ \('$cur'[^ ]*\).*$|\1|p' ) ) return 0 ;; esac } [ "$have" ] && complete -F _psql $default psql _longopt() { local cur opt cur=${COMP_WORDS[COMP_CWORD]} if [[ "$cur" == --*=* ]]; then opt=${cur%%=*} # cut backlash that gets inserted before '=' sign opt=${opt%\\*} cur=${cur#*=} _filedir COMPREPLY=( $( compgen -P "$opt=" -W '${COMPREPLY[@]}' -- $cur)) return 0 fi if [[ "$cur" == -* ]]; then COMPREPLY=( $( $1 --help 2>&1 | sed -e '/--/!d' \ -e 's/.*\(--[-A-Za-z0-9]\+=\?\).*/\1/' | \ grep "^$cur" | sort -u ) ) elif [[ "$1" == @(mk|rm)dir ]]; then _filedir -d else _filedir fi } # makeinfo and texi2dvi are defined elsewhere for i in a2ps autoconf automake bc gprof ld nm objcopy objdump readelf strip \ bison cpio diff patch enscript cp df dir du ln ls mkfifo mknod mv rm \ touch vdir xargs awk gperf grep gpg grub indent less m4 sed shar date \ env seq su tee uname who texindex cat csplit cut expand fmt fold head \ md5sum nl od paste pr ptx sha1sum sort split tac tail tr unexpand \ uniq wc units wget rsync ldd bash id info irb mkdir rmdir netstat; do have $i && complete -F _longopt $filenames $i done unset i # gcc(1) completion # # The only unusual feature is that we don't parse "gcc --help -v" output # directly, because that would include the options of all the other backend # tools (linker, assembler, preprocessor, etc) without any indication that # you cannot feed such options to the gcc driver directly. (For example, the # linker takes a -z option, but you must type -Wl,-z for gcc.) Instead, we # ask the driver ("g++") for the name of the compiler ("cc1"), and parse the # --help output of the compiler. # have gcc && _gcc() { local cur cc backend COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} _expand || return 0 case "$1" in gcj) backend=jc1 ;; gpc) backend=gpc1 ;; *77) backend=f771 ;; *) backend=cc1 # (near-)universal backend ;; esac if [[ "$cur" == -* ]]; then cc=$( $1 -print-prog-name=$backend ) # sink stderr: # for C/C++/ObjectiveC it's useless # for FORTRAN/Java it's an error COMPREPLY=( $( $cc --help 2>/dev/null | tr '\t' ' ' | \ sed -e '/^ *-/!d' -e 's/ *-\([^ ]*\).*/-\1/' | \ grep "^$cur" | sort -u ) ) else _filedir fi } [ "$have" ] && complete $filenames -F _gcc gcc g++ c++ g77 gcj gpc [ $OS = Linux ] && complete $filenames -F _gcc cc # Linux cardctl(8) completion # have cardctl && _cardctl() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [ $COMP_CWORD -eq 1 ]; then COMPREPLY=( $( compgen -W 'status config ident suspend \ resume reset eject insert scheme' \ -- $cur ) ) fi } [ "$have" ] && complete -F _cardctl cardctl # This function is required by _dpkg() and _dpkg-reconfigure() # have dpkg && _comp-dpkg-installed-packages() { grep-dctrl -r -F package -s package,status "^$1" /var/lib/dpkg/status \ | grep-dctrl -n -F status -s package installed } # Debian Linux dpkg(8) completion # have dpkg && _dpkg() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} # find the last option flag if [[ $cur != -* ]]; then while [[ $prev != -* && $COMP_CWORD != 1 ]]; do COMP_CWORD=$((COMP_CWORD-1)) prev=${COMP_WORDS[COMP_CWORD-1]} done fi case "$prev" in -i|--install|--unpack|-A|--record-avail|-c|--contents|-I|--info| \ --fsys-tarfile|-f|--field|-e|--control|-X|--extract) COMPREPLY=( $( compgen -f -X '!*.deb' -- $cur ) \ $( compgen -d -- $cur ) ) return 0 ;; -b|--build) COMPREPLY=( $( compgen -d -- $cur ) ) return 0 ;; -s|--status|-p|--print-avail|-l|--list) COMPREPLY=( $( apt-cache pkgnames $cur ) ) return 0 ;; -S|--search) _filedir return 0 ;; -r|--remove|--purge|-L|--listfiles) COMPREPLY=( $( _comp-dpkg-installed-packages $cur ) ) return 0 ;; *) ;; esac COMPREPLY=( $( compgen -W '-i --install --unpack -A --record-avail \ --configure -r --remove --purge --get-selections \ --set-selections --update-avail --merge-avail \ --clear-avail --command-fd --forget-old-unavail -s \ --status -p --print-avail -L --listfiles -l --list \ -S --search -C --audit --print-architecture \ --print-gnu-build-architecture \ --print-installation-architecture \ --compare-versions --help --version --force-help \ --force-all --force-auto-select --force-downgrade \ --force-configure-any --force-hold --force-bad-path \ --force-not-root --force-overwrite \ --force-overwrite-diverted --force-bad-verify \ --force-depends-version --force-depends \ --force-confnew --force-confold --force-confdef \ --force-miss --force-conflicts --force-architecture \ --force-overwrite-dir --force-remove-reinstreq \ --force-remove-essential -Dh \ --debug=help --licence --admindir= --root= --instdir= \ -O --selected-only -E --skip-same-version \ -G --refuse-downgrade -B --auto-deconfigure \ --no-debsig --no-act -D --debug= --status-fd \ -b --build -I --info -f --field -c --contents \ -x --extract -X --vextract --fsys-tarfile -e --control \ --ignore-depends= --abort-after' -- $cur ) ) } [ "$have" ] && complete -F _dpkg $filenames dpkg dpkg-deb # Debian Linux dpkg-reconfigure(8) completion # have dpkg-reconfigure && _dpkg-reconfigure() { local cur prev opt COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -@(f|-frontend)) opt=( $( echo /usr/share/perl5/Debconf/FrontEnd/* ) ) opt=( ${opt[@]##*/} ) opt=( ${opt[@]%.pm} ) COMPREPLY=( $( compgen -W '${opt[@]}' -- $cur ) ) return 0 ;; -@(p|-priority)) COMPREPLY=( $( compgen -W 'low medium high critical' -- $cur ) ) return 0 ;; esac if [[ "$cur" == -* ]]; then COMPREPLY=( $( compgen -W '-f --frontend -p --priority -a --all \ -u --unseen-only -h --help -s --showold \ --force --terse' -- $cur ) ) else COMPREPLY=( $( _comp-dpkg-installed-packages $cur ) ) fi } [ "$have" ] && complete -F _dpkg-reconfigure $default dpkg-reconfigure have java && _java() { local cur prev classpath i COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -@(cp|classpath)) _filedir return 0 ;; esac if [[ "$cur" == -* ]]; then # relevant options completion COMPREPLY=( $( compgen -W '-client -hotspot -server -classic \ -cp -classpath -D -verbose -version \ -showversion -? -help -X' -- $cur ) ) else # available classes completion # find wich classpath to use if [ -n "$CLASSPATH" ]; then classpath=$CLASSPATH else classpath=. fi for (( i=1; i < COMP_CWORD; i++ )); do if [[ "${COMP_WORDS[i]}" == -classpath ]] || \ [[ "${COMP_WORDS[i]}" == -cp ]]; then classpath=${COMP_WORDS[i+1]} break fi done # parse each classpath element for classes for i in ${classpath//:/ }; do if [ -f $i ] && [[ "$i" == *.@(jar|zip) ]]; then COMPREPLY=( ${COMPREPLY[@]} $( jar tf $i | \ grep '\.class' | sed -e 's|\.class||g' \ -e 's|/|.|g' | grep "^$cur" )) elif [ -d $i ]; then COMPREPLY=( ${COMPREPLY[@]} $( find $i -type f \ -name \*.class | \ sed -e 's|^'$i'/||' \ -e 's|\.class$||' \ -e 's|/|.|g' | grep "^$cur" ) ) fi done fi } [ "$have" ] && complete -F _java java _configure_func() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} # if $COMP_CONFIGURE_HINTS is not null, then completions of the form # --option=SETTING will include 'SETTING' as a contextual hint [[ "$cur" != -* ]] && return 0 if [ -n "$COMP_CONFIGURE_HINTS" ]; then COMPREPLY=( $( $1 --help | sed -ne 's|^ *\('$cur'[^ '$'\t'',[]\+\).*$|\1|p' ) ) else COMPREPLY=( $( $1 --help | sed -ne 's|^ *\('$cur'[^ '$'\t'',=[]\+=\?\).*$|\1|p' ) ) fi } complete -F _configure_func $default configure # urpmi media function required by other urpmi functions # have urpmi && _urpmi_media() { # return list of available urpmi media COMPREPLY=( $( awk -F'{' '/{/ {print $1}' /etc/urpmi/urpmi.cfg | \ grep "^$cur" )) } # Mandrake urpmi completion # have urpmi && _urpmi() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in --media) _urpmi_media return 0;; esac if [[ "$cur" == -* ]]; then # return list of available options COMPREPLY=( $( compgen -W '-a -p -P -y -s -q -v --help \ --update --media --auto --auto-select --fuzzy --src \ --noclean --complete --force --wget --curl --X \ --best-output' -- $cur ) ) else # return list of available packages COMPREPLY=( $( gzip -dc /var/lib/urpmi/synthesis.hdlist.* | \ awk -F'@' '/info/ {print $1}' | grep "^$cur" ) ) fi } [ "$have" ] && complete -F _urpmi urpmi # Mandrake urpmi.update completion # have urpmi.update && _urpmi_update() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [[ "$cur" == -* ]]; then # return list of available options COMPREPLY=( $( compgen -W '-a -c -d -f --curl --wget' -- $cur)) else # return list of available media _urpmi_media fi } [ "$have" ] && complete -F _urpmi_update urpmi.update # Mandrake urpmi.addmedia completion # have urpmi.addmedia && _urpmi_addmedia() { local cur i args COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [[ "$cur" == -* ]]; then # return list of available options COMPREPLY=( $( compgen -W '-c -h -f --wget --curl --update \ --distrib' -- $cur ) ) else # count number of mandatory args given sofar args=$COMP_CWORD for (( i=1; i < COMP_CWORD; i++ )); do if [[ "${COMP_WORDS[i]}" == -* ]]; then args=$(($args-1)) fi done case $args in 1) # return list of available media _urpmi_media ;; 2) # return list of available protocols COMPREPLY=( $( compgen -W 'file:// http:// \ ftp:// removable://' -- $cur ) ) ;; 3) # return word "with" COMPREPLY=( 'with' ) ;; esac fi } [ "$have" ] && complete -F _urpmi_addmedia urpmi.addmedia # Mandrake urpmi.removemedia completion # have urpmi.removemedia && _urpmi_removemedia() { local cur COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} if [[ "$cur" == -* ]]; then # if word begins with a dash, return list of available options COMPREPLY=( $( compgen -W '-a -c' -- $cur ) ) else # elsewhere, return list of available media _urpmi_media fi } [ "$have" ] && complete -F _urpmi_removemedia urpmi.removemedia # Debian Linux reportbug(1) completion # have reportbug && _reportbug() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -f|--filename|-i|--include|--mta|-o|--output) _filedir return 0 ;; -B|--bts) COMPREPLY=( $( compgen -W "debian guug kde mandrake help" -- \ $cur )) return 0 ;; -e|--editor|--mua) COMP_WORDS=(COMP_WORDS[0] $cur) COMP_CWORD=1 _command return 0 ;; --mode) COMPREPLY=( $( compgen -W "novice standard expert" -- $cur ) ) return 0 ;; -S|--severity) COMPREPLY=( $( compgen -W "grave serious important normal \ minor wishlist" -- $cur ) ) return 0; ;; -u|--ui|--interface) COMPREPLY=( $( compgen -W "newt text gnome" -- $cur ) ) return 0 ;; -t|--type) COMPREPLY=( $( compgen -W "gnats debbugs" -- $cur ) ) return 0; ;; -T|--tags) COMPREPLY=( $( compgen -W "none patch security upstream sid \ woody potato sarge fixed" -- $cur ) ) return 0; ;; *) ;; esac COMPREPLY=($( compgen -W '-h --help -v --version -a --af -b \ --no-query-bts --query-bts -B --bts -c --configure \ --no-config-files --check-available -d --debug \ --no-check-available -e --editor --email -f \ --filename -g --gnupg -H --header -i --include -j \ --justification -l --ldap --no-ldap -L --list-cc -m \ --maintonly --mode --mua --mta --mutt -n --mh --nmh \ -o --output -p --print -P --pgp --proxy --http_proxy\ -q --quiet -Q --query-only --realname --report-quiet \ --reply-to --replyto -s --subject -S --severity \ --smtphost -t --type -T --tags --template -V -x \ --no-cc --package-version -z --no-compress \ --ui --interface -u \ wnpp boot-floppies kernel-image' -- $cur ) \ $( apt-cache pkgnames -- $cur ) ) _filedir return 0 } [ "$have" ] && complete -F _reportbug $filenames reportbug # Debian Linux querybts(1) completion # have querybts && _querybts() { local cur prev COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} prev=${COMP_WORDS[COMP_CWORD-1]} case "$prev" in -B|--bts) COMPREPLY=( $( compgen -W "debian guug kde mandrake help" -- \ $cur )) return 0 ;; -u|--ui|--interface) COMPREPLY=($( compgen -W "newt text gnome" -- $cur )) return 0 ;; *) ;; esac COMPREPLY=($( compgen -W '-h --help -v --version -A --archive \ -B --bts -l --ldap --no-ldap --proxy= --http_proxy= \ -s --source -w --web -u --ui --interface \ wnpp boot-floppies' -- $cur ) \ $( apt-cache pkgnames -- $cur ) ) } [ "$have" ] && complete -F _querybts $filenames querybts _filedir_xspec() { local IFS cur xspec IFS=$'\t\n' COMPREPLY=() cur=${COMP_WORDS[COMP_CWORD]} _expand || return 0 # get first exclusion compspec that matches this command xspec=$( sed -ne '/ '${1##*/}'/{p;q;}' $BASH_COMPLETION ) # prune to leave nothing but the -X spec xspec=${xspec#*-X } xspec=${xspec%% *} COMPREPLY=( $( eval compgen -f -X "$xspec" -- \"$cur\" ) \ $( compgen -d -- $cur ) ) } list=( $( sed -ne '/^# START exclude/,/^# FINISH exclude/p' \ $BASH_COMPLETION | \ # read exclusion compspecs ( while read line do # ignore compspecs that are commented out if [ "${line#\#}" != "$line" ]; then continue; fi line=${line%# START exclude*} line=${line%# FINISH exclude*} line=${line##*\'} list=( ${list[@]} $line ) done echo ${list[@]} ) ) ) # remove previous compspecs if [ ${#list[@]} -gt 0 ]; then eval complete -r ${list[@]} # install new compspecs eval complete -F _filedir_xspec $filenames ${list[@]} fi unset list[@] # source Debian specific completion directory for i in /usr/share/bash_completion/*; do [ -r $i ] && . $i done # source completion directory definitions if [ -d $BASH_COMPLETION_DIR -a -r $BASH_COMPLETION_DIR -a \ -x $BASH_COMPLETION_DIR ]; then for i in $BASH_COMPLETION_DIR/*; do # On Debian, don't include any filenames containing # `.dpkg', omitting foo.dpkg-old, foo.dpkg-new, etc. case "$(basename $i)" in *.dpkg*) ;; *) [ -r $i ] && . $i esac done fi unset i # source user completion file [ $BASH_COMPLETION != ~/.bash_completion -a -r ~/.bash_completion ] \ && . ~/.bash_completion unset -f have unset OS RELEASE have default dirnames filenames nospace ### Local Variables: ### mode: shell-script ### End: # This is the main config file for debconf. It tells debconf where to # store data. The format of this file is a set of stanzas. Each stanza # except the first sets up a database for debconf to use. For details, see # debconf.conf(5) (in the debconf-doc package). # # So first things first. This first stanza gives the names of two databases. # Debconf will use this database to store the data you enter into it, # and some other dynamic data. Config: configdb # Debconf will use this database to store static template data. Templates: templatedb # Set up the configdb database. By default, it consists of a single flat # text file. Name: configdb Driver: File Filename: /var/cache/debconf/config.dat # Set up the templatedb database, which is likewise a single flat text file # by default. Name: templatedb Driver: File Mode: 644 Filename: /var/cache/debconf/templates.dat # Well that was pretty straightforward, and it will be enough for most # people's needs, but debconf's database drivers can be used to do much # more interesting things. For example, suppose you want to use config # data from another host, which is mounted over nfs or perhaps the database # is accessed via LDAP. You don't want to write to the remove debconf database, # just read from it, so you still need a local database for local changes. # # A remote NFS mounted database, read-only. It is optional; if debconf # fails to use it it will not abort. #Name: remotedb #Driver: DirTree #Directory: /mnt/otherhost/var/cache/debconf/config #Readonly: true #Required: false # # A remote LDAP database. It is also read-only. The password is really # only necessary if the database is not accessable anonymously. #Name: remotedb #Driver: LDAP #Server: remotehost #BaseDN: cn=debconf,dc=domain,dc=com #BindDN: uid=admin,dc=domain,dc=com #BindPasswd: secret # # A stack consisting of two databases. Values will be read from # the first database in the stack to contain a value. In this example, # writes always go to the first database. #Name: fulldb #Driver: Stack #Stack: configdb, remotedb # # In this example, we'd use Config: fulldb at the top of the file # to make it use the combination of the databases. # # Even more complex and interesting setups are possible, see the # debconf.conf(5) page for details. # This file sets environment variables which are used by updatedb # filesystems which are pruned from updatedb database PRUNEFS="NFS nfs afs proc smbfs autofs auto iso9660 ncpfs coda devpts ftpfs" export PRUNEFS # paths which are pruned from updatedb database PRUNEPATHS="/tmp /usr/tmp /var/tmp /afs /amd /alex /var/spool" export PRUNEPATHS # netpaths which are added NETPATHS="" export NETPATHS # ---------------------------------------------------------------------------# # /etc/pam.conf # # ---------------------------------------------------------------------------# # # NOTE # ---- # # NOTE: Most program use a file under the /etc/pam.d/ directory to setup their # PAM service modules. This file is used, but not recommended # ---------------------------------------------------------------------------# # Format: # serv. module ctrl module [path] ...[args..] # # name type flag # # # /etc/login.defs - Configuration control definitions for the login package. # # $Id: login.defs.linux,v 1.11 1999/08/27 19:02:50 marekm Exp $ # # Three items must be defined: MAIL_DIR, ENV_SUPATH, and ENV_PATH. # If unspecified, some arbitrary (and possibly incorrect) value will # be assumed. All other items are optional - if not specified then # the described action or option will be inhibited. # # Comment lines (lines beginning with "#") and blank lines are ignored. # # Modified for Linux. --marekm # # *REQUIRED* # Directory where mailboxes reside, _or_ name of file, relative to the # home directory. If you _do_ define both, MAIL_DIR takes precedence. # QMAIL_DIR is for Qmail (or any maildir-compatible MTA, such as Exim or # Postfix when suitably configured). # # Essentially, MAIL_DIR defines the $MAIL environmental variable # (for mbox use) by appending the username to MAIL_DIR as defined # below. MAIL_FILE defines the $MAIL environment variable as the # fully-qualified filename obtained by prepending the user home # directory before $MAIL_FILE, and QMAIL_DIR defines the MAIL # environment variable as the fully-qualified directory name # obtained by prepending the user home directory before $QMAIL_DIR. # # NOTE: This is used to setup your MAIL environment variable, and also # used by userdel to determine if any mail spools need to be removed when # removing a user. If you change this, you should also change the # pam_mail.so module setup in /etc/pam.d/login, which affects the "You # have mail" message on login, and, in default setup, overrides this setting # in determining the $MAIL environmental variable. # #QMAIL_DIR Maildir/ MAIL_DIR /var/mail #MAIL_FILE .mail # # Delay in seconds before being allowed another attempt after a login failure # FAIL_DELAY 3 # # Enable logging and display of /var/log/faillog login failure info. # FAILLOG_ENAB yes # # Enable display of unknown usernames when login failures are recorded. # LOG_UNKFAIL_ENAB no # # Enable logging of successful logins # LOG_OK_LOGINS no # # Enable setting of ulimit, umask, and niceness from passwd gecos field. # QUOTAS_ENAB yes # # Enable "syslog" logging of su activity - in addition to sulog file logging. # SYSLOG_SG_ENAB does the same for newgrp and sg. # SYSLOG_SU_ENAB yes SYSLOG_SG_ENAB yes # # If defined, all su activity is logged to this file. # #SULOG_FILE /var/log/sulog # # If defined, file which maps tty line to TERM environment parameter. # Each line of the file is in a format something like "vt100 tty01". # #TTYTYPE_FILE /etc/ttytype # # If defined, login failures will be logged here in a utmp format. # last, when invoked as lastb, will read /var/log/btmp, so... # FTMP_FILE /var/log/btmp # # If defined, the command name to display when running "su -". For # example, if this is defined as "su" then a "ps" will display the # command is "-su". If not defined, then "ps" would display the # name of the shell actually being run, e.g. something like "-sh". # SU_NAME su # # If defined, file which inhibits all the usual chatter during the login # sequence. If a full pathname, then hushed mode will be enabled if the # user's name or shell are found in the file. If not a full pathname, then # hushed mode will be enabled if the file exists in the user's home directory. # HUSHLOGIN_FILE .hushlogin #HUSHLOGIN_FILE /etc/hushlogins # # If defined, the presence of this value in an /etc/passwd "shell" field will # disable logins for that user, although "su" will still be allowed. # # XXX this does not seem to be implemented yet... --marekm # no, it was implemented but I ripped it out ;-) -- jfh NOLOGIN_STR NOLOGIN # # If defined, either a TZ environment parameter spec or the # fully-rooted pathname of a file containing such a spec. # #ENV_TZ TZ=CST6CDT #ENV_TZ /etc/tzname # # If defined, an HZ environment parameter spec. # # for Linux/x86 ENV_HZ HZ=100 # For Linux/Alpha... #ENV_HZ HZ=1024 # # *REQUIRED* The default PATH settings, for superuser and normal users. # # (they are minimal, add the rest in the shell startup files) ENV_SUPATH PATH=/sbin:/bin:/usr/sbin:/usr/bin:/usr/bin/X11:/usr/local/sbin:/usr/local/bin ENV_PATH PATH=/usr/local/bin:/usr/bin:/bin:/usr/bin/X11:/usr/games # # Terminal permissions # # TTYGROUP Login tty will be assigned this group ownership. # TTYPERM Login tty will be set to this permission. # # If you have a "write" program which is "setgid" to a special group # which owns the terminals, define TTYGROUP to the group number and # TTYPERM to 0620. Otherwise leave TTYGROUP commented out and assign # TTYPERM to either 622 or 600. # TTYGROUP tty TTYPERM 0600 # # Login configuration initializations: # # ERASECHAR Terminal ERASE character ('\010' = backspace). # KILLCHAR Terminal KILL character ('\025' = CTRL/U). # UMASK Default "umask" value. # ULIMIT Default "ulimit" value. # # The ERASECHAR and KILLCHAR are used only on System V machines. # The ULIMIT is used only if the system supports it. # (now it works with setrlimit too; ulimit is in 512-byte units) # # Prefix these values with "0" to get octal, "0x" to get hexadecimal. # ERASECHAR 0177 KILLCHAR 025 UMASK 022 #ULIMIT 2097152 # # Password aging controls: # # PASS_MAX_DAYS Maximum number of days a password may be used. # PASS_MIN_DAYS Minimum number of days allowed between password changes. # PASS_WARN_AGE Number of days warning given before a password expires. # PASS_MAX_DAYS 99999 PASS_MIN_DAYS 0 PASS_WARN_AGE 7 # # Min/max values for automatic uid selection in useradd # UID_MIN 1000 UID_MAX 60000 # # Min/max values for automatic gid selection in groupadd # GID_MIN 100 GID_MAX 60000 # # Max number of login retries if password is bad. This will most likely be # overriden by PAM, since the default pam_unix module has it's own built # in of 3 retries However, this is a safe fallback in case you are using # and authentication module that does not enforce PAM_MAXTRIES. # LOGIN_RETRIES 5 # # Max time in seconds for login # LOGIN_TIMEOUT 60 # # Number of significant characters in the password for crypt(). # Default is 8, don't change unless your crypt() is better. # If using MD5 in your PAM configuration, set this higher. # PASS_MAX_LEN 8 # # Require password before chfn/chsh can make any changes. # CHFN_AUTH yes # # Which fields may be changed by regular users using chfn - use # any combination of letters "frwh" (full name, room number, work # phone, home phone). If not defined, no changes are allowed. # For backward compatibility, "yes" = "rwh" and "no" = "frwh". # CHFN_RESTRICT rwh # # Password prompt (%s will be replaced by user name). # # XXX - it doesn't work correctly yet, for now leave it commented out # to use the default which is just "Password: ". #LOGIN_STRING "%s's Password: " # # Should login be allowed if we can't cd to the home directory? # Default in no. # DEFAULT_HOME yes # # If defined, this command is run when removing a user. # It should remove any at/cron/print jobs etc. owned by # the user to be removed (passed as the first argument). # #USERDEL_CMD /usr/sbin/userdel_local # # If defined, either full pathname of a file containing device names or # a ":" delimited list of device names. No password is required to log in # as a non-root user on these devices. # #NO_PASSWORD_CONSOLE tty1:tty2:tty3:tty4:tty5:tty6 # # When prompting for password without echo, getpass() can optionally # display a random number (in the range 1 to GETPASS_ASTERISKS) of '*' # characters for each character typed. This feature is designed to # confuse people looking over your shoulder when you enter a password :-). # Also, the new getpass() accepts both Backspace (8) and Delete (127) # keys to delete previous character (to cope with different terminal # types), Control-U to delete all characters, and beeps when there are # no more characters to delete, or too many characters entered. # # Setting GETPASS_ASTERISKS to 1 results in more traditional behaviour - # exactly one '*' displayed for each character typed. # # Setting GETPASS_ASTERISKS to 0 disables the '*' characters (Backspace, # Delete, Control-U and beep continue to work as described above). # # Setting GETPASS_ASTERISKS to -1 reverts to the traditional getpass() # without any new features. This is the default. # #GETPASS_ASTERISKS 1 # # Enable setting of the umask group bits to be the same as owner bits # (examples: 022 -> 002, 077 -> 007) for non-root users, if the uid is # the same as gid, and username is the same as the primary group name. # # This also enables userdel to remove user groups if no members exist. # USERGROUPS_ENAB yes # # Instead of the real user shell, the program specified by this parameter # will be launched, although its visible name (argv[0]) will be the shell's. # The program may do whatever it wants (logging, additional authentification, # banner, ...) before running the actual shell. # # FAKE_SHELL /bin/fakeshell # # Enable pam_close_session() calling. When using normal (pam_unix.so) # session handling modules, this is not needed. However with modules # (such as kerberos or other persistent session models), login and su # need to fork and wait for the shell to exit so that sessions can be # cleaned up. # CLOSE_SESSIONS no ################# OBSOLETED BY PAM ############## # # # These options are now handled by PAM. Please # # edit the appropriate file in /etc/pam.d/ to # # enable the equivelants of them. # ############### #MOTD_FILE #DIALUPS_CHECK_ENAB #LASTLOG_ENAB #MAIL_CHECK_ENAB #OBSCURE_CHECKS_ENAB #PORTTIME_CHECKS_ENAB #CONSOLE #SU_WHEEL_ONLY #CRACKLIB_DICTPATH #PASS_CHANGE_TRIES #PASS_ALWAYS_WARN #MD5_CRYPT_ENAB #CONSOLE_GROUPS #ENVIRON_FILE #NOLOGINS_FILE #ISSUE_FILE #PASS_MIN_LEN # /etc/securetty: list of terminals on which root is allowed to login. # See securetty(5) and login(1). console # Standard consoles tty1 tty2 tty3 tty4 tty5 tty6 tty7 tty8 tty9 tty10 tty11 tty12 # Same as above, but these only occur with devfs devices vc/1 vc/2 vc/3 vc/4 vc/5 vc/6 vc/7 vc/8 vc/9 vc/10 vc/11 vc/12 # /etc/shells: valid login shells /bin/ash /bin/bash /bin/csh /bin/sh /usr/bin/es /usr/bin/ksh /bin/ksh /usr/bin/rc /usr/bin/tcsh /bin/tcsh /usr/bin/zsh /bin/sash /bin/zsh /usr/bin/esh # # /etc/sysctl.conf - Configuration file for setting system variables # See sysctl.conf (5) for information. # #kernel.domainname = example.com #net/ipv4/icmp_echo_ignore_broadcasts=1 .N .. S20makedev S99rmnologinS89cronS20inetdS20eximS89atdS14pppS11klogd S10sysklogdS20sshS20zebraS15bindS20acpid0 S23ntp#!/bin/sh # # This is not a mistake. This shell script (/etc/rmt) has been provided # for compatibility with other Unix-like systems, some of which have # utilities that expect to find (and execute) rmt in the /etc directory # on remote systems. # exec /usr/sbin/rmt # /etc/fstab: static file system information. # # /dev/ram0 / ext2 defaults,errors=remount-ro 0 1 proc /proc proc defaults 0 0 /dev/hda1 /flash vfat noauto,defaults devpts /dev/pts devpts rw,gid=5,mode=620 0 0 none /proc proc rw 0 0 root:x:0:0:root:/root:/bin/bash daemon:x:1:1:daemon:/usr/sbin:/bin/sh bin:x:2:2:bin:/bin:/bin/sh sys:x:3:3:sys:/dev:/bin/sh sync:x:4:100:sync:/bin:/bin/sync games:x:5:100:games:/usr/games:/bin/sh man:x:6:100:man:/var/cache/man:/bin/sh lp:x:7:7:lp:/var/spool/lpd:/bin/sh mail:x:8:8:mail:/var/mail:/bin/sh news:x:9:9:news:/var/spool/news:/bin/sh uucp:x:10:10:uucp:/var/spool/uucp:/bin/sh proxy:x:13:13:proxy:/bin:/bin/sh postgres:x:31:32:postgres:/var/lib/postgres:/bin/sh www-data:x:33:33:www-data:/var/www:/bin/sh backup:x:34:34:backup:/var/backups:/bin/sh operator:x:37:37:Operator:/var:/bin/sh list:x:38:38:SmartList:/var/list:/bin/sh irc:x:39:39:ircd:/var:/bin/sh gnats:x:41:41:Gnats Bug-Reporting System (admin):/var/lib/gnats:/bin/sh nobody:x:65534:65534:nobody:/home:/bin/sh sshd:x:100:65534::/var/run/sshd:/bin/false ld.so-1.7.0Cx#8Vh)7JWmx  + = O j w       ' 8 L e u      . : K [ t      ' 4 J W m {      , = L ` k {      +;Pc (2AM^mglibc-ld.so.cache1.1CY x#8Vh)7JWmx  + = O j w       ' 8 L e u      . : K [ t      ' 4 J W m {      , = L ` k {      +;Pc (2AM^mlibz.so.1/usr/lib/libz.so.1libwrap.so.0/lib/libwrap.so.0libuuid.so.1/lib/libuuid.so.1libutil.so.1/lib/libutil.so.1libucdmibs-0.4.2.so/usr/lib/libucdmibs-0.4.2.solibucdagent-0.4.2.so/usr/lib/libucdagent-0.4.2.solibthread_db.so.1/lib/libthread_db.so.1libstdc++-libc6.2-2.so.3/usr/lib/libstdc++-libc6.2-2.so.3libssl.so.0.9.6/usr/lib/libssl.so.0.9.6libss.so.2/lib/libss.so.2libsnmp-0.4.2.so/usr/lib/libsnmp-0.4.2.solibslang.so.1/lib/libslang.so.1libsasl.so.7/usr/lib/libsasl.so.7librt.so.1/lib/librt.so.1libresolv.so.2/lib/libresolv.so.2libreadline.so.4/lib/libreadline.so.4libpthread.so.0/lib/libpthread.so.0libproc.so.2.0.7/lib/libproc.so.2.0.7libpopt.so.0/lib/libpopt.so.0libpcreposix.so.3/usr/lib/libpcreposix.so.3libpcre.so.3/usr/lib/libpcre.so.3libpcap.so.0/usr/lib/libpcap.so.0libpanel.so.5/usr/lib/libpanel.so.5libpamc.so.0/lib/libpamc.so.0libpam_misc.so.0/lib/libpam_misc.so.0libpam.so.0/lib/libpam.so.0libnss_nisplus.so.2/lib/libnss_nisplus.so.2libnss_nis.so.2/lib/libnss_nis.so.2libnss_hesiod.so.2/lib/libnss_hesiod.so.2libnss_files.so.2/lib/libnss_files.so.2libnss_dns.so.2/lib/libnss_dns.so.2libnss_compat.so.2/lib/libnss_compat.so.2libnsl.so.1/lib/libnsl.so.1libnewt.so.0.50/usr/lib/libnewt.so.0.50libncurses.so.5/lib/libncurses.so.5libmenu.so.5/usr/lib/libmenu.so.5libm.so.6/lib/libm.so.6liblockfile.so.1/usr/lib/liblockfile.so.1libldap_r.so.2/usr/lib/libldap_r.so.2libldap.so.2/usr/lib/libldap.so.2liblber.so.2/usr/lib/liblber.so.2libident.so.0/usr/lib/libident.so.0libhistory.so.4/lib/libhistory.so.4libgdbm.so.2/usr/lib/libgdbm.so.2libgdbm.so.1/usr/lib/libgdbm.so.1libform.so.5/usr/lib/libform.so.5libe2p.so.2/lib/libe2p.so.2libext2fs.so.2/lib/libext2fs.so.2libdl.so.2/lib/libdl.so.2libdb3.so.3/usr/lib/libdb3.so.3libdb2.so.2/lib/libdb2.so.2libdb1.so.2/lib/libdb1.so.2libdb.so.3/lib/libdb.so.3libdb.so.2/lib/libdb.so.2libdb-3.so/usr/lib/libdb-3.solibctutils.so.0/lib/libctutils.so.0libcrypto.so.0.9.6/usr/lib/libcrypto.so.0.9.6libcrypt.so.1/lib/libcrypt.so.1libconsole.so.0/lib/libconsole.so.0libcom_err.so.2/lib/libcom_err.so.2libcfont.so.0/lib/libcfont.so.0libcap.so.1/lib/libcap.so.1libc.so.6/lib/libc.so.6libanl.so.1/lib/libanl.so.1libSegFault.so/lib/libSegFault.solibBrokenLocale.so.1/lib/libBrokenLocale.so.1ld-linux.so.2/lib/ld-linux.so.2Linux debian 2.4.18 #7 Tue Jul 30 13:02:13 CEST 2002 i686 unknown Most of the programs included with the Debian GNU/Linux system are freely redistributable; the exact distribution terms for each program are described in the individual files in /usr/share/doc/*/copyright Debian GNU/Linux comes with ABSOLUTELY NO WARRANTY, to the extent permitted by applicable law. 0.000000 1012000000 0.000000 1012000000 UTC # /etc/inittab: init(8) configuration. # # WARNING: This file is installed by the Debian boot disks. # It is not meant to be used by default, but only to make # sure that certain configurations are done after the initial # boot into a new system. The real inittab is most likely # named /etc/inittab.real. # # $Id: inittab.install,v 1.8 2001/10/03 09:05:05 rhirst Exp $ id:2:initdefault: si::sysinit:/etc/init.d/rcS ~~:S:wait:/sbin/sulogin l0:0:wait:/etc/init.d/rc 0 l1:1:wait:/etc/init.d/rc 1 l2:2:wait:/etc/init.d/rc 2 l3:3:wait:/etc/init.d/rc 3 l4:4:wait:/etc/init.d/rc 4 l5:5:wait:/etc/init.d/rc 5 l6:6:wait:/etc/init.d/rc 6 ca:12345:ctrlaltdel:/sbin/shutdown -t1 -a -r now kb::kbrequest:/bin/echo "Keyboard Request--edit /etc/inittab to let this work." pf::powerwait:/etc/init.d/powerfail start pn::powerfailnow:/etc/init.d/powerfail now po::powerokwait:/etc/init.d/powerfail stop 1:2345:respawn:/sbin/getty 38400 tty1 2:23:respawn:/sbin/getty 38400 tty2 3:23:respawn:/sbin/getty 38400 tty3 # For serial-console installs (will be edited by base configuration) # T0:23:respawn:/sbin/getty -L ttyS0 9600 vt100 # T1:23:respawn:/sbin/getty -L ttyS1 9600 vt100 # T2:23:respawn:/sbin/getty -L ttyS2 9600 vt100 # T3:23:respawn:/sbin/getty -L ttyS3 9600 vt100 # T4:23:respawn:/sbin/getty -L ttyS4 9600 vt100 # T5:23:respawn:/sbin/getty -L ttyS5 9600 vt100 ### This file is automatically generated by update-modules" # # Please do not edit this file directly. If you want to change or add # anything please take a look at the files in /etc/modutils and read # the manpage for update-modules. # ### update-modules: start processing /etc/modutils/0keep # DO NOT MODIFY THIS FILE! # This file is not marked as conffile to make sure if you upgrade modutils # it will be restored in case some modifications have been made. # # The keep command is necessary to prevent insmod and friends from ignoring # the builtin defaults of a path-statement is encountered. Until all other # packages use the new `add path'-statement this keep-statement is essential # to keep your system working keep ### update-modules: end processing /etc/modutils/0keep ### update-modules: start processing /etc/modutils/actions # Special actions that are needed for some modules # The BTTV module does not load the tuner module automatically, # so do that in here post-install bttv insmod tuner post-remove bttv rmmod tuner ### update-modules: end processing /etc/modutils/actions ### update-modules: start processing /etc/modutils/aliases # Aliases to tell insmod/modprobe which modules to use # Uncomment the network protocols you don't want loaded: # alias net-pf-1 off # Unix # alias net-pf-2 off # IPv4 # alias net-pf-3 off # Amateur Radio AX.25 # alias net-pf-4 off # IPX # alias net-pf-5 off # DDP / appletalk # alias net-pf-6 off # Amateur Radio NET/ROM # alias net-pf-9 off # X.25 # alias net-pf-10 off # IPv6 # alias net-pf-11 off # ROSE / Amateur Radio X.25 PLP # alias net-pf-19 off # Acorn Econet alias char-major-10-175 agpgart alias char-major-10-200 tun alias char-major-81 bttv alias char-major-108 ppp_generic alias /dev/ppp ppp_generic alias tty-ldisc-3 ppp_async alias tty-ldisc-14 ppp_synctty alias ppp-compress-21 bsd_comp alias ppp-compress-24 ppp_deflate alias ppp-compress-26 ppp_deflate # Crypto modules (see http://www.kerneli.org/) alias loop-xfer-gen-0 loop_gen alias loop-xfer-3 loop_fish2 alias loop-xfer-gen-10 loop_gen alias cipher-2 des alias cipher-3 fish2 alias cipher-4 blowfish alias cipher-6 idea alias cipher-7 serp6f alias cipher-8 mars6 alias cipher-11 rc62 alias cipher-15 dfc2 alias cipher-16 rijndael alias cipher-17 rc5 ### update-modules: end processing /etc/modutils/aliases ### update-modules: start processing /etc/modutils/paths # This file contains a list of paths that modprobe should scan, # beside the once that are compiled into the modutils tools # themselves. ### update-modules: end processing /etc/modutils/paths ### update-modules: start processing /etc/modutils/ppp alias /dev/ppp ppp_generic alias char-major-108 ppp_generic alias tty-ldisc-3 ppp_async alias tty-ldisc-14 ppp_synctty alias ppp-compress-21 bsd_comp alias ppp-compress-24 ppp_deflate alias ppp-compress-26 ppp_deflate ### update-modules: end processing /etc/modutils/ppp ### update-modules: start processing /etc/modutils/setserial # # This is what I wanted to do, but logger is in /usr/bin, which isn't loaded # when the module is first loaded into the kernel at boot time! # #post-install serial /etc/init.d/setserial start | logger -p daemon.info -t "setserial-module reload" #pre-remove serial /etc/init.d/setserial stop | logger -p daemon.info -t "setserial-module uload" # alias /dev/tts serial alias /dev/tts/0 serial alias /dev/tts/1 serial alias /dev/tts/2 serial alias /dev/tts/3 serial post-install serial /etc/init.d/setserial modload > /dev/null 2> /dev/null pre-remove serial /etc/init.d/setserial modsave > /dev/null 2> /dev/null ### update-modules: end processing /etc/modutils/setserial ### update-modules: start processing /etc/modutils/arch/i386 alias parport_lowlevel parport_pc alias char-major-10-144 nvram alias binfmt-0064 binfmt_aout alias char-major-10-135 rtc ### update-modules: end processing /etc/modutils/arch/i386 # /etc/adduser.conf: `adduser' configuration. # See adduser(8) and adduser.conf(5) for full documentation. # The DSHELL variable specifies the default login shell on your # system. DSHELL=/bin/bash # The DHOME variable specifies the directory containing users' home # directories. DHOME=/home # If GROUPHOMES is "yes", then the home directories will be created as # /home/groupname/user. GROUPHOMES=no # If LETTERHOMES is "yes", then the created home directories will have # an extra directory - the first letter of the user name. For example: # /home/u/user. LETTERHOMES=no # The SKEL variable specifies the directory containing "skeletal" user # files; in other words, files such as a sample .profile that will be # copied to the new user's home directory when it is created. SKEL=/etc/skel # FIRST_SYSTEM_UID to LAST_SYSTEM_UID inclusive is the range for UIDs # for dynamically allocated administrative and system accounts. FIRST_SYSTEM_UID=100 LAST_SYSTEM_UID=999 # FIRST_UID to LAST_UID inclusive is the range of UIDs of dynamically # allocated user accounts. FIRST_UID=1000 LAST_UID=29999 # The USERGROUPS variable can be either "yes" or "no". If "yes" each # created user will be given their own group to use as a default, and # their home directories will be g+s. If "no", each created user will # be placed in the group whose gid is USERS_GID (see below). USERGROUPS=yes # If USERGROUPS is "no", then USERS_GID should be the GID of the group # `users' (or the equivalent group) on your system. USERS_GID=100 # If QUOTAUSER is set, a default quota will be set from that user with # `edquota -p QUOTAUSER newuser' QUOTAUSER="" # If DIR_MODE is set, directories will be created with the specified # mode. Otherwise the default mode 0755 will be used. DIR_MODE=0751 # If SETGID_HOME is "yes" home directories for users with their own # group the setgid bit will be set. This was the default for # versions << 3.13 of adduser. Because it has some bad side effects we # no longer do this per default. If you want it nevertheless you can # still set it here. SETGID_HOME=no # see "man logrotate" for details # rotate log files weekly weekly # keep 4 weeks worth of backlogs rotate 4 # create new (empty) log files after rotating old ones create # uncomment this if you want your log files compressed #compress # packages drop log rotation information into this directory include /etc/logrotate.d # no packages own wtmp, or btmp -- we'll rotate them here /var/log/wtmp { monthly create 0664 root utmp rotate 1 } /var/log/btmp { missingok monthly create 0664 root utmp rotate 1 } # system-specific logs may be configured here # /etc/rpc: # $Id: rpc,v 2.1 1997/06/11 17:14:15 tobias Exp $ # # rpc 88/08/01 4.0 RPCSRC; from 1.12 88/02/07 SMI portmapper 100000 portmap sunrpc rstatd 100001 rstat rstat_svc rup perfmeter rusersd 100002 rusers nfs 100003 nfsprog ypserv 100004 ypprog mountd 100005 mount showmount ypbind 100007 walld 100008 rwall shutdown yppasswdd 100009 yppasswd etherstatd 100010 etherstat rquotad 100011 rquotaprog quota rquota sprayd 100012 spray 3270_mapper 100013 rje_mapper 100014 selection_svc 100015 selnsvc database_svc 100016 rexd 100017 rex alis 100018 sched 100019 llockmgr 100020 nlockmgr 100021 x25.inr 100022 statmon 100023 status 100024 bootparam 100026 ypupdated 100028 ypupdate keyserv 100029 keyserver tfsd 100037 nsed 100038 nsemntd 100039 pcnfsd 150001 amd 300019 amq sgi_fam 391002 ugidd 545580417 bwnfsd 788585389 root:x:0: daemon:x:1: bin:x:2: sys:x:3: adm:x:4: tty:x:5: disk:x:6: lp:x:7:lp mail:x:8: news:x:9: uucp:x:10: proxy:x:13: kmem:x:15: dialout:x:20: fax:x:21: voice:x:22: cdrom:x:24: floppy:x:25: tape:x:26: sudo:x:27: audio:x:29: dip:x:30: postgres:x:32: www-data:x:33: backup:x:34: operator:x:37: list:x:38: irc:x:39: src:x:40: gnats:x:41: shadow:x:42: utmp:x:43: video:x:44: staff:x:50: games:x:60: users:x:100: nogroup:x:65534: .N .. base-configzebra# This is the log file for the installation of debian, and for base-config. # Useful mainly for post-morten debugging, and if the install went ok, it # will normally be deleted after one month. /var/log/installer.log { rotate 4 weekly compress delaycompress missingok nocreate } /var/log/installer.timings { rotate 4 weekly compress delaycompress missingok nocreate } /var/log/zebra/*.log { daily missingok compress rotate 14 create 640 root root postrotate for i in zebra bgpd ripd ospfd ripngd ospf6d; do if [ -e /var/run/$i.pid ] ; then kill -USR1 `cat /var/run/$i.pid` fi done endscript } # /etc/hosts.allow: list of hosts that are allowed to access the system. # See the manual pages hosts_access(5), hosts_options(5) # and /usr/doc/netbase/portmapper.txt.gz # # Example: ALL: LOCAL @some_netgroup # ALL: .foobar.edu EXCEPT terminalserver.foobar.edu # # If you're going to protect the portmapper use the name "portmap" for the # daemon name. Remember that you can only use the keyword "ALL" and IP # addresses (NOT host or domain names) for the portmapper. See portmap(8) # and /usr/doc/portmap/portmapper.txt.gz for further information. # .N .. lib openssl.cnf ...# # OpenSSL example configuration file. # This is mostly being used for generation of certificate requests. # # This definition stops the following lines choking if HOME isn't # defined. HOME = . RANDFILE = $ENV::HOME/.rnd # Extra OBJECT IDENTIFIER info: #oid_file = $ENV::HOME/.oid oid_section = new_oids # To use this configuration file with the "-extfile" option of the # "openssl x509" utility, name here the section containing the # X.509v3 extensions to use: # extensions = # (Alternatively, use a configuration file that has only # X.509v3 extensions in its main [= default] section.) [ new_oids ] # We can add new OIDs in here for use by 'ca' and 'req'. # Add a simple OID like this: # testoid1=1.2.3.4 # Or use config file substitution like this: # testoid2=${testoid1}.5.6 #################################################################### [ ca ] default_ca = CA_default # The default ca section #################################################################### [ CA_default ] dir = ./demoCA # Where everything is kept certs = $dir/certs # Where the issued certs are kept crl_dir = $dir/crl # Where the issued crl are kept database = $dir/index.txt # database index file. new_certs_dir = $dir/newcerts # default place for new certs. certificate = $dir/cacert.pem # The CA certificate serial = $dir/serial # The current serial number crl = $dir/crl.pem # The current CRL private_key = $dir/private/cakey.pem# The private key RANDFILE = $dir/private/.rand # private random number file x509_extensions = usr_cert # The extentions to add to the cert # Extensions to add to a CRL. Note: Netscape communicator chokes on V2 CRLs # so this is commented out by default to leave a V1 CRL. # crl_extensions = crl_ext default_days = 365 # how long to certify for default_crl_days= 30 # how long before next CRL default_md = md5 # which md to use. preserve = no # keep passed DN ordering # A few difference way of specifying how similar the request should look # For type CA, the listed attributes must be the same, and the optional # and supplied fields are just that :-) policy = policy_match # For the CA policy [ policy_match ] countryName = match stateOrProvinceName = match organizationName = match organizationalUnitName = optional commonName = supplied emailAddress = optional # For the 'anything' policy # At this point in time, you must list all acceptable 'object' # types. [ policy_anything ] countryName = optional stateOrProvinceName = optional localityName = optional organizationName = optional organizationalUnitName = optional commonName = supplied emailAddress = optional #################################################################### [ req ] default_bits = 1024 default_keyfile = privkey.pem distinguished_name = req_distinguished_name attributes = req_attributes x509_extensions = v3_ca # The extentions to add to the self signed cert # Passwords for private keys if not present they will be prompted for # input_password = secret # output_password = secret # This sets a mask for permitted string types. There are several options. # default: PrintableString, T61String, BMPString. # pkix : PrintableString, BMPString. # utf8only: only UTF8Strings. # nombstr : PrintableString, T61String (no BMPStrings or UTF8Strings). # MASK:XXXX a literal mask value. # WARNING: current versions of Netscape crash on BMPStrings or UTF8Strings # so use this option with caution! string_mask = nombstr # req_extensions = v3_req # The extensions to add to a certificate request [ req_distinguished_name ] countryName = Country Name (2 letter code) countryName_default = AU countryName_min = 2 countryName_max = 2 stateOrProvinceName = State or Province Name (full name) stateOrProvinceName_default = Some-State localityName = Locality Name (eg, city) 0.organizationName = Organization Name (eg, company) 0.organizationName_default = Internet Widgits Pty Ltd # we can do this but it is not needed normally :-) #1.organizationName = Second Organization Name (eg, company) #1.organizationName_default = World Wide Web Pty Ltd organizationalUnitName = Organizational Unit Name (eg, section) #organizationalUnitName_default = commonName = Common Name (eg, YOUR name) commonName_max = 64 emailAddress = Email Address emailAddress_max = 60 # SET-ex3 = SET extension number 3 [ req_attributes ] challengePassword = A challenge password challengePassword_min = 4 challengePassword_max = 20 unstructuredName = An optional company name [ usr_cert ] # These extensions are added when 'ca' signs a request. # This goes against PKIX guidelines but some CAs do it and some software # requires this to avoid interpreting an end user certificate as a CA. basicConstraints=CA:FALSE # Here are some examples of the usage of nsCertType. If it is omitted # the certificate can be used for anything *except* object signing. # This is OK for an SSL server. # nsCertType = server # For an object signing certificate this would be used. # nsCertType = objsign # For normal client use this is typical # nsCertType = client, email # and for everything including object signing: # nsCertType = client, email, objsign # This is typical in keyUsage for a client certificate. # keyUsage = nonRepudiation, digitalSignature, keyEncipherment # This will be displayed in Netscape's comment listbox. nsComment = "OpenSSL Generated Certificate" # PKIX recommendations harmless if included in all certificates. subjectKeyIdentifier=hash authorityKeyIdentifier=keyid,issuer:always # This stuff is for subjectAltName and issuerAltname. # Import the email address. # subjectAltName=email:copy # Copy subject details # issuerAltName=issuer:copy #nsCaRevocationUrl = http://www.domain.dom/ca-crl.pem #nsBaseUrl #nsRevocationUrl #nsRenewalUrl #nsCaPolicyUrl #nsSslServerName [ v3_req ] # Extensions to add to a certificate request basicConstraints = CA:FALSE keyUsage = nonRepudiation, digitalSignature, keyEncipherment [ v3_ca ] # Extensions for a typical CA # PKIX recommendation. subjectKeyIdentifier=hash authorityKeyIdentifier=keyid:always,issuer:always # This is what PKIX recommends but some broken software chokes on critical # extensions. #basicConstraints = critical,CA:true # So we do this instead. basicConstraints = CA:true # Key usage: this is typical for a CA certificate. However since it will # prevent it being used as an test self-signed certificate it is best # left out by default. # keyUsage = cRLSign, keyCertSign # Some might want this also # nsCertType = sslCA, emailCA # Include email address in subject alt name: another PKIX recommendation # subjectAltName=email:copy # Copy issuer details # issuerAltName=issuer:copy # DER hex encoding of an extension: beware experts only! # obj=DER:02:03 # Where 'obj' is a standard or added object # You can even override a supported extension: # basicConstraints= critical, DER:30:03:01:01:FF [ crl_ext ] # CRL extensions. # Only issuerAltName and authorityKeyIdentifier make any sense in a CRL. # issuerAltName=issuer:copy authorityKeyIdentifier=keyid:always,issuer:always .N ..sysklogd,man-dbntp-simple.dpkg-new ntp-simple#! /bin/sh # sysklogd Cron script to rotate system log files weekly. # # If you want to rotate logfiles daily, edit # this script and /etc/cron.daily/sysklogd to get # the logfiles in sync (they must not occur in both # files). Do not delete this file itself, since # it will then be replaced after an upgrade creating # unwanted effects. # # This is a configration file. You are invited to edit # it and maintain it on your own. You'll have to do # that if you don't like the default policy # wrt. rotating logfiles (i.e. with large logfiles # weekly and daily rotation may interfere). If you edit # this file and don't let dpkg upgrade it, you have full # control over it. Please read the manpage to # syslogd-listfiles. # # Written by Ian A. Murdock . # $Id: cron.weekly,v 1.7 2002/01/01 11:41:36 joey Exp $ test -x /usr/sbin/syslogd-listfiles || exit 0 test -x /sbin/syslogd || exit 0 test -d /usr/share/doc/sysklogd || exit 0 set -e cd /var/log for LOG in `syslogd-listfiles --weekly` do if [ -s $LOG ]; then savelog -g adm -m 640 -u root -c 4 $LOG >/dev/null fi done # Restart syslogd # /etc/init.d/sysklogd reload-or-restart #!/bin/sh # # Last modification: Wed, 13 Jun 2001 14:41:48 +0100 # man-db cron weekly # regenerate man database if [ -x /usr/bin/mandb ]; then # --pidfile /dev/null so it always starts; mandb isn't really a daemon, # but we want to start it like one. start-stop-daemon --start --pidfile /dev/null \ --startas /usr/lib/man-db/mandb --oknodo --chuid man \ >/dev/null 2>/dev/null fi .N ..standard#!/bin/sh # /etc/cron.monthly/standard: standard monthly maintenance script # rotation of wtmp and btmp taken over by logrotate # /etc/crontab: system-wide crontab # Unlike any other crontab you don't have to run the `crontab' # command to install the new version when you edit this file. # This file also has a username field, that none of the other crontabs do. SHELL=/bin/sh PATH=/usr/local/sbin:/usr/local/bin:/sbin:/bin:/usr/sbin:/usr/bin # m h dom mon dow user command 25 6 * * * root test -e /usr/sbin/anacron || run-parts --report /etc/cron.daily 47 6 * * 7 root test -e /usr/sbin/anacron || run-parts --report /etc/cron.weekly 52 6 1 * * root test -e /usr/sbin/anacron || run-parts --report /etc/cron.monthly # # /etc/hosts.deny: list of hosts that are _not_ allowed to access the system. # See the manual pages hosts_access(5), hosts_options(5) # and /usr/doc/netbase/portmapper.txt.gz # # Example: ALL: some.host.name, .some.domain # ALL EXCEPT in.fingerd: other.host.name, .other.domain # # If you're going to protect the portmapper use the name "portmap" for the # daemon name. Remember that you can only use the keyword "ALL" and IP # addresses (NOT host or domain names) for the portmapper. See portmap(8) # and /usr/doc/portmap/portmapper.txt.gz for further information. # # The PARANOID wildcard matches any host whose name does not match its # address. You may wish to enable this to ensure any programs that don't # validate looked up hostnames still leave understandable logs. In past # versions of Debian this has been the default. # ALL: PARANOID # This is /etc/email-addresses. It is part of the exim package # # This file contains email addresses to use for outgoing mail. Any local # part not in here will be qualified by the system domain as normal. # # It should contain lines of the form: # #user: someone@isp.com #otheruser: someoneelse@anotherisp.com set ask askcc append dot save crt ignore Received Message-Id Resent-Message-Id Status Mail-From Return-Path Via Delivered-To # manpath.config # # This file is used by the man_db package to configure the man and cat paths. # It is also used to provide a manpath for those without one by examining # their PATH environment variable. For details see the manpath(5) man page. # # Lines beginning with `#' are comments and are ignored. Any combination of # tabs or spaces may be used as `whitespace' separators. # # There are three mappings allowed in this file: # -------------------------------------------------------- # MANDATORY_MANPATH manpath_element # MANPATH_MAP path_element manpath_element # MANDB_MAP global_manpath [relative_catpath] #--------------------------------------------------------- # every automatically generated MANPATH includes these fields # #MANDATORY_MANPATH /usr/src/pvm3/man # MANDATORY_MANPATH /usr/man MANDATORY_MANPATH /usr/share/man MANDATORY_MANPATH /usr/X11R6/man MANDATORY_MANPATH /usr/local/man #--------------------------------------------------------- # set up PATH to MANPATH mapping # ie. what man tree holds man pages for what binary directory. # # *PATH* -> *MANPATH* # MANPATH_MAP /bin /usr/share/man MANPATH_MAP /usr/bin /usr/share/man MANPATH_MAP /sbin /usr/share/man MANPATH_MAP /usr/sbin /usr/share/man MANPATH_MAP /usr/local/bin /usr/local/man MANPATH_MAP /usr/local/bin /usr/local/share/man MANPATH_MAP /usr/local/sbin /usr/local/man MANPATH_MAP /usr/local/sbin /usr/local/share/man MANPATH_MAP /usr/X11R6/bin /usr/X11R6/man MANPATH_MAP /usr/bin/X11 /usr/X11R6/man MANPATH_MAP /usr/games /usr/share/man MANPATH_MAP /opt/bin /opt/man MANPATH_MAP /opt/sbin /opt/man #--------------------------------------------------------- # For a manpath element to be treated as a system manpath (as most of those # above should normally be), it must be mentioned below. Each line may have # an optional extra string indicating the catpath associated with the # manpath. If no catpath string is used, the catpath will default to the # given manpath. # # You *must* provide all system manpaths, including manpaths for alternate # operating systems, locale specific manpaths, and combinations of both, if # they exist, otherwise the permissions of the user running man/mandb will # be used to manipulate the manual pages. Also, mandb will not initialise # the database cache for any manpaths not mentioned below unless explicitly # requested to do so. # # In a per-user configuration file, this directive only controls the # location of catpaths and the creation of database caches; it has no effect # on privileges. # # Any manpaths that are subdirectories of other manpaths must be mentioned # *before* the containing manpath. E.g. /usr/man/preformat must be listed # before /usr/man. # # *MANPATH* -> *CATPATH* # MANDB_MAP /usr/man /var/cache/man/fsstnd MANDB_MAP /usr/share/man /var/cache/man MANDB_MAP /usr/local/man /var/cache/man/oldlocal MANDB_MAP /usr/local/share/man /var/cache/man/local MANDB_MAP /usr/X11R6/man /var/cache/man/X11R6 MANDB_MAP /opt/man /var/cache/man/opt # #--------------------------------------------------------- # Program definitions. These are commented out by default as the value # of the definition is already the default. To change: uncomment a # definition and modify it. # #DEFINE pager exec /usr/bin/pager -s #DEFINE cat /bin/cat #DEFINE tr /usr/bin/tr '\255\267\264\327' '\055\157\047\170' #DEFINE grep /bin/grep #DEFINE troff /usr/bin/groff -mandoc #DEFINE nroff /usr/bin/nroff -mandoc #DEFINE eqn /usr/bin/eqn #DEFINE neqn /usr/bin/neqn #DEFINE tbl /usr/bin/tbl #DEFINE col /usr/bin/col #DEFINE vgrind /usr/bin/vgrind #DEFINE refer /usr/bin/refer #DEFINE grap /usr/bin/grap #DEFINE pic /usr/bin/pic -S # #DEFINE decompressor /bin/gzip -dc #DEFINE compressor /bin/gzip -c7 #--------------------------------------------------------- # Misc definitions: same as program definitions above. # #DEFINE whatis_grep_flags -i #DEFINE apropos_grep_flags -iEw #DEFINE apropos_regex_grep_flags -iE #--------------------------------------------------------- # Section names. Manual sections will be searched in the order listed here; # the default is 1, n, l, 8, 3, 2, 5, 4, 9, 6, 7. Multiple SECTION # directives may be given for clarity, and will be concatenated together in # the expected way. # If a particular extension is not in this list (say, 1mh), it will be # displayed with the rest of the section it belongs to. The effect of this # is that you only need to explicitly list extensions if you want to force a # particular order. Sections with extensions should usually be adjacent to # their main section (e.g. "1 1mh 8 ..."). SECTION 1 n l 8 3 2 3pm 3perl 3tcl 3tk 5 4 9 6 7 alias backup bin daemon ftp games gnats guest irc lp mail man nobody operator proxy qmaild qmaill qmailp qmailq qmailr qmails sync sys www-data .N .. if-pre-up.dif-up.d if-down.d+if-post-down.d interfacesoptions spoof-protectinterfaces.dpkg-old@ifstate .$.. vlan.dpkg-new'vlan . .. ip.dpkg-new(ip ...# /etc/network/interfaces -- configuration file for ifup(8), ifdown(8) # The loopback interface auto lo iface lo inet loopback # The first network card - this entry was created during the Debian installation auto eth0 iface eth0 inet dhcp ip_forward=no spoofprotect=yes syncookies=no # default spoof protection configuration # # this is only necessary for pre-2.2 kernels. # (it can be determined automatically under 2.2.x) LOCAL_IPS="127.0.0.1/8" LOCAL_IFACES="eth0 eth1 ppp0" # Used by ifup(8) and ifdown(8). See the interfaces(5) manpage or # /usr/share/doc/ifupdown/examples for more information. lo=lo eth0=eth0 # /etc/gateways: # # NAME1 gateway NAME2 metric VALUE # /etc/protocols: # $Id: protocols,v 1.1 1995/02/24 01:09:41 imurdock Exp $ # # Internet (IP) protocols # # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # Updated for NetBSD based on RFC 1340, Assigned Numbers (July 1992). ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # "reliable datagram" protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport ipv6 41 IPv6 # IPv6 ipv6-route 43 IPv6-Route # Routing Header for IPv6 ipv6-frag 44 IPv6-Frag # Fragment Header for IPv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation esp 50 ESP # Encap Security Payload for IPv6 ah 51 AH # Authentication Header for IPv6 skip 57 SKIP # SKIP ipv6-icmp 58 IPv6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPv6-NoNxt # No Next Header for IPv6 ipv6-opts 60 IPv6-Opts # Destination Options for IPv6 rspf 73 RSPF # Radio Shortest Path First. vmtp 81 VMTP # Versatile Message Transport ospf 89 OSPFIGP # Open Shortest Path First IGP ipip 94 IPIP # IP-within-IP Encapsulation Protocol encap 98 ENCAP # Yet Another IP encapsulation pim 103 PIM # Protocol Independent Multicast # /etc/services: # $Id: services,v 1.4 1997/05/20 19:41:21 tobias Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1700, ``Assigned Numbers'' (October 1994). Not all ports # are included, only the more common ones. tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp ftp 21/tcp fsp 21/udp fspd ssh 22/tcp # SSH Remote Login Protocol ssh 22/udp # SSH Remote Login Protocol telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname re-mail-ck 50/tcp # Remote Mail Checking Protocol re-mail-ck 50/udp # Remote Mail Checking Protocol domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink kerberos 88/tcp kerberos5 krb5 kerberos-sec # Kerberos v5 kerberos 88/udp kerberos5 krb5 kerberos-sec # Kerberos v5 supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns # unfortunately the poppassd (Eudora) uses a port which has already # been assigned to a different service. We list the poppassd as an # alias here. This should work for programs asking for this service. # (due to a bug in inetd the 3com-tsmux line is disabled) #3com-tsmux 106/tcp poppassd #3com-tsmux 106/udp poppassd rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice pop-2 # POP version 2 pop2 109/udp pop-2 pop3 110/tcp pop-3 # POP version 3 pop3 110/udp pop-3 sunrpc 111/tcp portmapper # RPC 4.0 portmapper TCP sunrpc 111/udp portmapper # RPC 4.0 portmapper UDP auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol pwdgen 129/tcp # PWDGEN service pwdgen 129/udp # PWDGEN service netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp imap # Interim Mail Access Proto v2 imap2 143/udp imap snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp mailq 174/tcp # Mailer transport queue for Zmailer mailq 174/udp # Mailer transport queue for Zmailer xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp qmtp 209/tcp # The Quick Mail Transfer Protocol qmtp 209/udp # The Quick Mail Transfer Protocol z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 rpc2portmap 369/tcp rpc2portmap 369/udp # Coda portmapper codaauth2 370/tcp codaauth2 370/udp # Coda authentication server ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp ldap 389/tcp # Lightweight Directory Access Protocol ldap 389/udp # Lightweight Directory Access Protocol https 443/tcp # MCom https 443/udp # MCom snpp 444/tcp # Simple Network Paging Protocol snpp 444/udp # Simple Network Paging Protocol saft 487/tcp # Simple Asynchronous File Transfer saft 487/udp # Simple Asynchronous File Transfer npmp-local 610/tcp dqs313_qmaster # npmp-local / DQS npmp-local 610/udp dqs313_qmaster # npmp-local / DQS npmp-gui 611/tcp dqs313_execd # npmp-gui / DQS npmp-gui 611/udp dqs313_execd # npmp-gui / DQS hmmp-ind 612/tcp dqs313_intercell# HMMP Indication / DQS hmmp-ind 612/udp dqs313_intercell# HMMP Indication / DQS ipp 631/tcp # Internet Printing Protocol ipp 631/udp # Internet Printing Protocol # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts gdomap 538/tcp # GNUstep distributed objects gdomap 538/udp # GNUstep distributed objects uucp 540/tcp uucpd # uucp daemon afpovertcp 548/tcp # AFP over TCP afpovertcp 548/udp # AFP over TCP remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem klogin 543/tcp # Kerberized `rlogin' (v5) kshell 544/tcp krcmd # Kerberized `rsh' (v5) nntps 563/tcp snntp # NNTP over SSL nntps 563/udp snntp # NNTP over SSL ldaps 636/tcp # LDAP over SSL ldaps 636/udp # LDAP over SSL tinc 655/tcp # tinc control port tinc 655/udp # tinc packet port kerberos-adm 749/tcp # Kerberos `kadmin' (v5) # webster 765/tcp # Network dictionary webster 765/udp rsync 873/tcp # rsync rsync 873/udp # rsync ftps-data 989/tcp # FTP over SSL (data) ftps 990/tcp # FTP over SSL telnets 992/tcp # Telnet over SSL telnets 992/udp # Telnet over SSL imaps 993/tcp # IMAP over SSL imaps 993/udp # IMAP over SSL ircs 994/tcp # IRC over SSL ircs 994/udp # IRC over SSL pop3s 995/tcp # POP-3 over SSL pop3s 995/udp # POP-3 over SSL # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # socks 1080/tcp # socks proxy server socks 1080/udp # socks proxy server lotusnote 1352/tcp lotusnotes # Lotus Note lotusnote 1352/udp lotusnotes # Lotus Note ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp datametrics 1645/tcp old-radius # datametrics / old radius entry datametrics 1645/udp old-radius # datametrics / old radius entry sa-msg-port 1646/tcp old-radacct # sa-msg-port / old radacct entry sa-msg-port 1646/udp old-radacct # sa-msg-port / old radacct entry radius 1812/tcp # Radius radius 1812/udp # Radius radius-acct 1813/tcp radacct # Radius Accounting radius-acct 1813/udp radacct # Radius Accounting rtcm-sc104 2101/tcp # RTCM SC-104 IANA 1/29/99 rtcm-sc104 2101/udp # RTCM SC-104 IANA 1/29/99 cvspserver 2401/tcp # CVS client/server operations cvspserver 2401/udp # CVS client/server operations venus 2430/tcp # codacon port venus 2430/udp # Venus callback/wbc interface venus-se 2431/tcp # tcp side effects venus-se 2431/udp # udp sftp side effect codasrv 2432/tcp # not used codasrv 2432/udp # server port codasrv-se 2433/tcp # tcp side effects codasrv-se 2433/udp # udp sftp side effect mon 2583/tcp # MON mon 2583/udp # MON dict 2628/tcp # Dictionary server dict 2628/udp # Dictionary server gds_db 3050/tcp # InterBase server gds_db 3050/udp # InterBase server icpv2 3130/tcp icp # Internet Cache Protocol (Squid) icpv2 3130/udp icp # Internet Cache Protocol (Squid) mysql 3306/tcp # MySQL mysql 3306/udp # MySQL rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only cfengine 5308/tcp # CFengine cfengine 5308/udp # CFengine x11 6000/tcp x11-0 # X windows system x11 6000/udp x11-0 # X windows system x11-1 6001/tcp # X windows system x11-1 6001/udp # X windows system x11-2 6002/tcp # X windows system x11-2 6002/udp # X windows system x11-3 6003/tcp # X windows system x11-3 6003/udp # X windows system x11-4 6004/tcp # X windows system x11-4 6004/udp # X windows system x11-5 6005/tcp # X windows system x11-5 6005/udp # X windows system x11-6 6006/tcp # X windows system x11-6 6006/udp # X windows system x11-7 6007/tcp # X windows system x11-7 6007/udp # X windows system afs3-fileserver 7000/tcp bbs # file server itself afs3-fileserver 7000/udp bbs # file server itself afs3-callback 7001/tcp # callbacks to cache managers afs3-callback 7001/udp # callbacks to cache managers afs3-prserver 7002/tcp # users & groups database afs3-prserver 7002/udp # users & groups database afs3-vlserver 7003/tcp # volume location database afs3-vlserver 7003/udp # volume location database afs3-kaserver 7004/tcp # AFS/Kerberos authentication afs3-kaserver 7004/udp # AFS/Kerberos authentication afs3-volser 7005/tcp # volume managment server afs3-volser 7005/udp # volume managment server afs3-errors 7006/tcp # error interpretation service afs3-errors 7006/udp # error interpretation service afs3-bos 7007/tcp # basic overseer process afs3-bos 7007/udp # basic overseer process afs3-update 7008/tcp # server-to-server updater afs3-update 7008/udp # server-to-server updater afs3-rmtsys 7009/tcp # remote cache manager service afs3-rmtsys 7009/udp # remote cache manager service font-service 7100/tcp xfs # X Font Service font-service 7100/udp xfs # X Font Service wnn6 22273/tcp # wnn6 wnn6 22273/udp # wnn6 #========================================================================= # The remaining port numbers are not as allocated by IANA. # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v4 should uncomment these and comment out the v5 entries above. # kerberos4 750/udp kerberos-iv kdc # Kerberos (server) udp kerberos4 750/tcp kerberos-iv kdc # Kerberos (server) tcp kerberos_master 751/udp # Kerberos authentication kerberos_master 751/tcp # Kerberos authentication passwd_server 752/udp # Kerberos passwd server krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # Kerberos registration kpasswd 761/tcp kpwd # Kerberos "passwd" swat 901/tcp # swat kpop 1109/tcp # Pop with Kerberos knetd 2053/tcp # Kerberos de-multiplexor zephyr-srv 2102/udp # Zephyr server zephyr-clt 2103/udp # Zephyr serv-hm connection zephyr-hm 2104/udp # Zephyr hostmanager eklogin 2105/tcp # Kerberos encrypted rlogin # Hmmm. Are we using Kv4 or Kv5 now? Worrying. # The following is probably Kerberos v5 --- ajt@debian.org (11/02/2000) kx 2111/tcp # X over Kerberos # # Unofficial but necessary (for NetBSD) services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging # # Datagram Delivery Protocol services # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol # # Services added for the Debian GNU/Linux distribution # linuxconf 98/tcp # LinuxConf poppassd 106/tcp # Eudora poppassd 106/udp # Eudora imsp 406/tcp # Interactive Mail Support Protocol imsp 406/udp # Interactive Mail Support Protocol ssmtp 465/tcp smtps # SMTP over SSL nqs 607/tcp # Network Queuing system moira_db 775/tcp # Moira database moira_update 777/tcp # Moira update protocol. moira_ureg 779/udp # Moira user registration. omirr 808/tcp omirrd # online mirror omirr 808/udp omirrd # online mirror customs 1001/tcp # pmake customs server customs 1001/udp # pmake customs server rmiregistry 1099/tcp # Java RMI Registry skkserv 1178/tcp # skk jisho server port predict 1210/udp # predict -- satellite tracking rmtcfg 1236/tcp # Gracilis Packeten remote config server xtel 1313/tcp # french minitel xtelw 1314/tcp # french minitel support 1529/tcp # GNATS sieve 2000/tcp # Sieve mail filter daemon cfinger 2003/tcp lmtp # GNU Finger / Local Mail Transfer Protocol ndtp 2010/tcp # Network dictionary transfer protocol ninstall 2150/tcp # ninstall service ninstall 2150/udp # ninstall service zebrasrv 2600/tcp # zebra service zebra 2601/tcp # zebra vty ripd 2602/tcp # RIPd vty ripngd 2603/tcp # RIPngd vty ospfd 2604/tcp # OSPFd vty bgpd 2605/tcp # BGPd vty ospf6d 2606/tcp # OSPF6d vty afbackup 2988/tcp # Afbackup system afbackup 2988/udp # Afbackup system afmbackup 2989/tcp # Afmbackup system afmbackup 2989/udp # Afmbackup system xtell 4224/tcp # xtell server fax 4557/tcp # FAX transmission service (old) hylafax 4559/tcp # HylaFAX client-server protocol (new) pcrd 5151/tcp # PCR-1000 Daemon noclog 5354/tcp # noclogd with TCP (nocol) noclog 5354/udp # noclogd with UDP (nocol) hostmon 5355/tcp # hostmon uses TCP (nocol) hostmon 5355/udp # hostmon uses UDP (nocol) postgres 5432/tcp # POSTGRES postgres 5432/udp # POSTGRES mrtd 5674/tcp # MRT Routing Daemon bgpsim 5675/tcp # MRT Routing Simulator canna 5680/tcp # cannaserver sane 6566/tcp saned # SANE network scanner daemon ircd 6667/tcp # Internet Relay Chat ircd 6667/udp # Internet Relay Chat ircd-dalnet 7000/tcp # IRC - Dalnet ircd-dalnet 7000/udp # IRC - Dalnet webcache 8080/tcp # WWW caching service webcache 8080/udp # WWW caching service tproxy 8081/tcp # Transparent Proxy tproxy 8081/udp # Transparent Proxy omniorb 8088/tcp # OmniORB omniorb 8088/udp # OmniORB mandelspawn 9359/udp mandelbrot # network mandelbrot amanda 10080/udp # amanda backup services kamanda 10081/tcp # amanda backup services (Kerberos) kamanda 10081/udp # amanda backup services (Kerberos) amandaidx 10082/tcp # amanda backup services amidxtape 10083/tcp # amanda backup services smsqp 11201/tcp # Alamin SMS gateway smsqp 11201/udp # Alamin SMS gateway xpilot 15345/tcp # XPilot Contact Port xpilot 15345/udp # XPilot Contact Port isdnlog 20011/tcp # isdn logging system isdnlog 20011/udp # isdn logging system vboxd 20012/tcp # voice box system vboxd 20012/udp # voice box system binkp 24554/tcp # Binkley binkp 24554/udp # Binkley asp 27374/tcp # Address Search Protocol asp 27374/udp # Address Search Protocol dircproxy 57000/tcp # Detachable IRC Proxy tfido 60177/tcp # Ifmail tfido 60177/udp # Ifmail fido 60179/tcp # Ifmail fido 60179/udp # Ifmail # Local services # /etc/syslog.conf Configuration file for syslogd. # # For more information see syslog.conf(5) # manpage. # # First some standard logfiles. Log by facility. # auth,authpriv.* /var/log/auth.log *.*;auth,authpriv.none -/var/log/syslog #cron.* /var/log/cron.log daemon.* -/var/log/daemon.log kern.* -/var/log/kern.log lpr.* -/var/log/lpr.log mail.* -/var/log/mail.log user.* -/var/log/user.log uucp.* /var/log/uucp.log # # Logging for the mail system. Split it up so that # it is easy to write scripts to parse these files. # mail.info -/var/log/mail.info mail.warn -/var/log/mail.warn mail.err /var/log/mail.err # Logging for INN news system # news.crit /var/log/news/news.crit news.err /var/log/news/news.err news.notice -/var/log/news/news.notice # # Some `catch-all' logfiles. # *.=debug;\ auth,authpriv.none;\ news.none;mail.none -/var/log/debug *.=info;*.=notice;*.=warn;\ auth,authpriv.none;\ cron,daemon.none;\ mail,news.none -/var/log/messages # # Emergencies are sent to everybody logged in. # *.emerg * # # I like to have messages displayed on the console, but only on a virtual # console I usually leave idle. # #daemon,mail.*;\ # news.=crit;news.=err;news.=notice;\ # *.=debug;*.=info;\ # *.=notice;*.=warn /dev/tty8 # The named pipe /dev/xconsole is for the `xconsole' utility. To use it, # you must invoke `xconsole' with the `-file' option: # # $ xconsole -file /dev/xconsole [...] # # NOTE: adjust the list below, or you'll go crazy if you have a reasonably # busy site.. # daemon.*;mail.*;\ news.crit;news.err;news.notice;\ *.=debug;*.=info;\ *.=notice;*.=warn |/dev/xconsole # /etc/inittab: init(8) configuration. # $Id: inittab,v 1.91 2002/01/25 13:35:21 miquels Exp $ # The default runlevel. id:2:initdefault: # Boot-time system configuration/initialization script. # This is run first except when booting in emergency (-b) mode. si::sysinit:/etc/init.d/rcS # What to do in single-user mode. ~~:S:wait:/sbin/sulogin # /etc/init.d executes the S and K scripts upon change # of runlevel. # # Runlevel 0 is halt. # Runlevel 1 is single-user. # Runlevels 2-5 are multi-user. # Runlevel 6 is reboot. l0:0:wait:/etc/init.d/rc 0 l1:1:wait:/etc/init.d/rc 1 l2:2:wait:/etc/init.d/rc 2 l3:3:wait:/etc/init.d/rc 3 l4:4:wait:/etc/init.d/rc 4 l5:5:wait:/etc/init.d/rc 5 l6:6:wait:/etc/init.d/rc 6 # Normally not reached, but fallthrough in case of emergency. z6:6:respawn:/sbin/sulogin # What to do when CTRL-ALT-DEL is pressed. ca:12345:ctrlaltdel:/sbin/shutdown -t1 -a -r now # Action on special keypress (ALT-UpArrow). #kb::kbrequest:/bin/echo "Keyboard Request--edit /etc/inittab to let this work." # What to do when the power fails/returns. pf::powerwait:/etc/init.d/powerfail start pn::powerfailnow:/etc/init.d/powerfail now po::powerokwait:/etc/init.d/powerfail stop # /sbin/getty invocations for the runlevels. # # The "id" field MUST be the same as the last # characters of the device (after "tty"). # # Format: # ::: # # Note that on most Debian systems tty7 is used by the X Window System, # so if you want to add more getty's go ahead but skip tty7 if you run X. # 1:2345:respawn:/sbin/getty 38400 tty1 2:23:respawn:/sbin/getty 38400 tty2 3:23:respawn:/sbin/getty 38400 tty3 4:23:respawn:/sbin/getty 38400 tty4 5:23:respawn:/sbin/getty 38400 tty5 6:23:respawn:/sbin/getty 38400 tty6 # Example how to put a getty on a serial line (for a terminal) # #T0:23:respawn:/sbin/getty -L ttyS0 9600 vt100 #T1:23:respawn:/sbin/getty -L ttyS1 9600 vt100 # Example how to put a getty on a modem line. # #T3:23:respawn:/sbin/mgetty -x0 -s 57600 ttyS3 linuxrouter 127.0.0.1 debian localhost # /etc/lilo.conf - See: `lilo(8)' and `lilo.conf(5)', # --------------- `install-mbr(8)', `/usr/share/doc/lilo/', # and `/usr/share/doc/mbr/'. # +---------------------------------------------------------------+ # | !! Reminder !! | # | | # | Don't forget to run `lilo' after you make changes to this | # | conffile, `/boot/bootmess.txt', or install a new kernel. The | # | computer will most likely fail to boot if a kernel-image | # | post-install script or you don't remember to run `lilo'. | # | | # +---------------------------------------------------------------+ # Support LBA for large hard disks. # lba32 # Overrides the default mapping between harddisk names and the BIOS' # harddisk order. Use with caution. #disk=/dev/hde # bios=0x81 #disk=/dev/sda # bios=0x80 # Specifies the boot device. This is where Lilo installs its boot # block. It can be either a partition, or the raw device, in which # case it installs in the MBR, and will overwrite the current MBR. # boot=/dev/hda # Specifies the device that should be mounted as root. (`/') # root=/dev/hda1 # Enable map compaction: # Tries to merge read requests for adjacent sectors into a single # read request. This drastically reduces load time and keeps the # map smaller. Using `compact' is especially recommended when # booting from a floppy disk. It is disabled here by default # because it doesn't always work. # # compact # Installs the specified file as the new boot sector # You have the choice between: bmp, compat, menu and text # Look in /boot/ and in lilo.conf(5) manpage for details # install=/boot/boot-menu.b # Specifies the location of the map file # map=/boot/map # You can set a password here, and uncomment the `restricted' lines # in the image definitions below to make it so that a password must # be typed to boot anything but a default configuration. If a # command line is given, other than one specified by an `append' # statement in `lilo.conf', the password will be required, but a # standard default boot will not require one. # # This will, for instance, prevent anyone with access to the # console from booting with something like `Linux init=/bin/sh', # and thus becoming `root' without proper authorization. # # Note that if you really need this type of security, you will # likely also want to use `install-mbr' to reconfigure the MBR # program, as well as set up your BIOS to disallow booting from # removable disk or CD-ROM, then put a password on getting into the # BIOS configuration as well. Please RTFM `install-mbr(8)'. # # password=tatercounter2000 # Specifies the number of deciseconds (0.1 seconds) LILO should # wait before booting the first image. # delay=20 # You can put a customized boot message up if you like. If you use # `prompt', and this computer may need to reboot unattended, you # must specify a `timeout', or it will sit there forever waiting # for a keypress. `single-key' goes with the `alias' lines in the # `image' configurations below. eg: You can press `1' to boot # `Linux', `2' to boot `LinuxOLD', if you uncomment the `alias'. # # message=/boot/bootmess.txt # prompt # single-key # delay=100 # timeout=100 # Specifies the VGA text mode at boot time. (normal, extended, ask, ) # # vga=ask # vga=9 # vga=normal # Kernel command line options that apply to all installed images go # here. See: The `boot-prompt-HOWO' and `kernel-parameters.txt' in # the Linux kernel `Documentation' directory. # # append="" # Boot up Linux by default. # default=Linux image=/vmlinuz label=Linux read-only # restricted # alias=1 image=/vmlinuz.old label=LinuxOLD read-only optional # restricted # alias=2 # If you have another OS on this machine to boot, you can uncomment the # following lines, changing the device name on the `other' line to # where your other OS' partition is. # # other=/dev/hda4 # label=HURD # restricted # alias=3 # /etc/inetd.conf: see inetd(8) for further informations. # # Internet server configuration database # # # Lines starting with "#:LABEL:" or "##" should not # be changed unless you know what you are doing! # # If you want to disable an entry so it isn't touched during # package updates just comment it out with a single '#' character. # # Packages should modify this file by using update-inetd(8) # # # #:INTERNAL: Internal services #echo stream tcp nowait root internal #echo dgram udp wait root internal #chargen stream tcp nowait root internal #chargen dgram udp wait root internal discard stream tcp nowait root internal discard dgram udp wait root internal daytime stream tcp nowait root internal #daytime dgram udp wait root internal time stream tcp nowait root internal #time dgram udp wait root internal #:STANDARD: These are standard services. #:BSD: Shell, login, exec and talk are BSD protocols. #:MAIL: Mail, news and uucp services. #disabled#smtp stream tcp nowait mail /usr/sbin/exim exim -bs #:INFO: Info services #:BOOT: Tftp service is provided primarily for booting. Most sites # run this only on machines acting as "boot servers." #:RPC: RPC based services #:HAM-RADIO: amateur-radio services #:OTHER: Other services .N ..moduli ssh_host_key ssh_configssh_host_key.pubssh_host_rsa_keyssh_host_rsa_key.pubssh_host_dsa_keyssh_host_dsa_key.pub0 sshd_config# $OpenBSD: moduli,v 1.1 2001/06/22 22:07:54 provos Exp $ # Time Type Tests Tries Size Generator Modulus 20010328182134 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF5449C221CB 20010328182222 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF5449C95A43 20010328182256 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF5449CC8CFB 20010328182409 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF5449D9BDB7 20010328182628 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF5449FB6EF3 20010328182708 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A000153 20010328182758 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A06E9EB 20010328182946 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A1F2C93 20010328183015 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A206ADB 20010328183112 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A2A109B 20010328183143 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A2BC1BB 20010328183301 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A3ADCEB 20010328183532 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A5E8BAF 20010328183646 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A6D54D7 20010328183712 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544A6EC46F 20010328184223 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544AB8626F 20010328184337 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544AC7DC73 20010328184634 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544AEFF073 20010328184714 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544AF594FF 20010328184807 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544AFEEC53 20010328184910 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B0B3513 20010328185030 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B165707 20010328185334 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B3A9673 20010328185423 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B426623 20010328185451 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B4427DB 20010328185637 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B5E3FC7 20010328185720 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B65964B 20010328185757 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B6A9373 20010328185844 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B7203B3 20010328185933 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B7A9FFF 20010328190006 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B7DAAD3 20010328190054 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B855C2F 20010328190139 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B8C53EB 20010328190304 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544B9F26C3 20010328190329 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544BA00697 20010328190412 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544BA54313 20010328190506 2 6 100 1023 5 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544BAEEF27 20010328190550 2 6 100 1023 2 DCFAC4EFE89F5B082962AB9A67E8D63E84FA491E5D3874978815868595469163DA0661E6208A8C2CD4F83893B53864ADFD2154E8D8EFA146BAD808562E4BF6C90348FD79EEB3387D93FC7943BC450BA55399BA3CF3DFBD0D4E71800007B0E9D5F12E7A2CB7EA4E49812E715F8DC570C478DC2DEB1C49B0AE87A5DF544BB5CE0B 20010328200734 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC33395187 20010328201124 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC334ED15B 20010328201358 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3359FC07 20010328201537 2 6 100 1534 2 6./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwDFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC335F7A83 20010328201829 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC336D1433 20010328202120 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC337B253B 20010328202848 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC33A3D43F 20010328203335 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC33BF24A3 20010328204332 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC34011B8B 20010328204443 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3402A92F 20010328204617 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3406D343 20010328205458 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3436FA2B 20010328210413 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3471CF1B 20010328213513 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC352AF5EF 20010328215014 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC358CC3CB 20010328215520 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35A9B7FF 20010328215733 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35B2927F 20010328220114 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35C47323 20010328220334 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35CFA9C3 20010328220653 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35E0BB37 20010328220915 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35E9CC23 20010328221256 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC35FD7D67 20010328221457 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC36052CCB 20010328222639 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC364A1E07 20010328224126 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC36AD5557 20010328225125 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC36EE57BF 20010328225751 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3716A70B 20010328225943 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC371D010B 20010328230054 2 6 100 1534 5 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC371EB5C7 20010328230301 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC37275F4B 20010328230628 2 6 100 1534 2 6DFD16D9669EDAF42EF5D4EED82AA84B0541DEC2045B6AF55021A184F32BCADE614A114137022C9A8B41C09AFC38199E7305864F70A8708F37FC2127264ECF4FA32391F243CC62B89602D3813082679E5BDF496BA9DFA4C818AD21EC261B6F11841E6F2DE1574CE95095841DAF052868CCD5E9BFCA543E0934B50A76A598E693136DE2D479AEF3785D97BAFF4FB85AB8D46DA424C4CC5E11ABCAF718837E16350982BF8A27728318EC02C71ED164F57CDB121B72614B7B7C406613EC3738C3F3 20010329000424 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853ACAACAB 20010329001637 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853AE5BE0F 20010329002229 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853AEDE2D3 20010329003652 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853B0F32CB 20010329005040 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853B30E503 20010329014643 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853BC9AF57 20010329021950 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853C205263 20010329023256 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853C3F2E53 20010329031049 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853CA28BBF 20010329032045 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853CB81103 20010329052113 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853DF13B47 20010329052449 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853DF3ED53 20010329060404 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853E5D25E7 20010329062856 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853E9CF013 20010329063152 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853E9E1CEB 20010329070601 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853EF58B7F 20010329071302 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853F017697 20010329072011 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853F0E72D3 20010329072445 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853F14CE17 20010329073641 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853F2EEBA3 20010329075209 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853F52E927 20010329080750 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853F776F8B 20010329084002 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853FC98043 20010329084744 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853FD7EAAF 20010329090209 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993853FF9AF5F 20010329093527 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC3499385404E330B 20010329094652 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC349938540672D1F 20010329103445 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC349938540E4B213 20010329111418 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC34993854144947F 20010329112031 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC3499385414F223B 20010329112413 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC349938541522073 20010329114209 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC3499385417C8E53 20010329125026 2 6 100 2046 2 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC3499385422E41AB 20010329132045 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC3499385427DD3FF 20010329134105 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC349938542AFA2D7 20010329134914 2 6 100 2046 5 7ED0888B660A818F15E5F76A7F2BF10C99D74129DA04446C60116C9C800501060B8AFF075DCE0C08CEFDF695440E6F16FCCDB06359D080EF62D6485CBAEB94B92BE771D535B4EA9C5D14D84CD7649E25C7CFEA2C914486CC2BFDE77C4C0DF1D6DDED65FEE2F53A7FA690AFE38EE00C154FBAEFF935466B176CB0AED02458A552929F4EA7FC3E6F9F758DE7F22CC1F49641F492820441BDC109F0CE18F883FC93EA9AC4C1432682BA1C5B67BED8C861152A5F952A8CDCF1BCE02B8D93E80C113CE9FE2E4ACA49B2978B99A8C5FA231A77F5E7C604D44C7C6EA98D561294D4F7AB061432CAB8BBDCEC3659DE64F65265E6B9FC5F46879BB17CC349938542C04A37 20010403222140 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0AB16DAF 20010403225231 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0AC56CFF 20010404053436 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0C2F4B7F 20010404092851 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0D04E7F7 20010404093943 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0D07794B 20010404102659 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0D2BE8CF 20010404112553 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0D5D012B 20010404174625 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0EA59E17 20010404184645 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0ED6DA4F 20010404193402 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0EFB39B3 20010404230716 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B0FB07C1B 20010405044433 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B10DD9FC3 20010405053429 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B11038737 20010405062826 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B112E24E7 20010405092601 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B11C9E9FB 20010405113007 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B123803EB 20010405122212 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B12612ED3 20010405182035 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B13A25087 20010405210758 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B142C4E23 20010405220222 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B145878F3 20010406020130 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B152AF6AB 20010406053538 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B15E78C8B 20010406073014 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1649BFEF 20010406074100 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B164D4E3F 20010406103625 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B16E07B33 20010406131946 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B17706243 20010406170234 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B182FD957 20010406182949 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B18768903 20010406203157 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B18DCFC3B 20010407022825 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1A1AF797 20010407071024 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1B1551E7 20010407112402 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1BF78EC7 20010407123215 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1C30021B 20010407161504 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1CF27743 20010407171629 2 6 100 3190 5 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1D25FAD7 20010407191502 2 6 100 3190 2 669BA3ED661F226A090BE5644A2BB4209371B78FC3E6848A095821993F59084CA5EE12052F977D01F0666F03F6573B199DFEC9AB94588C2C60DE3B3E7CF5094587919FCC3FB40A61C261E891A0F91D9FFC8F30CA12CF809DD8290DD786FA8B041FFAC5793C38F38757EA6790472AC2692185B554B0046E8C065C983C0ACC8D2F85AB4BEDF7CE233009218C9691FE44261580D4149F1D4471B0B5DF79E224252474EBC3B7B5490950BB438BF498E79F8794498B3A3B5FBB42829C3BBEA4067F28C23BE40377B986BD5443CCCF02405B8CCCAA09E8179F0168D4969994171A6AD98F81015BC84E10A44E1EFD2E0862C5D1AAFE99014715A36800DBD9A6C51C0226CC82A651DAE4F73D54C4D103C13D1C15CF8CCA67D5CB39F03C66F3B7467F8FFDCC5074CD0C1B2538FBF956971BF39314CEDD20E1B10DE16D86E10BE7FA5B1A706AEB4C356F49807A22072CD00559AF0A863788956651919E26A315EAD1D26E7C98FC4CFA35A0F04DD400A2991A1FFE5B271FEDE54375896A29F968BE1D511BA466A92AC3E3772709FC815B1D8C2753 20010420002705 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10C1E08F3 20010420005243 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10C219FB3 20010420035225 2 6 100 4094 5 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10C660B3F 20010420145749 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10D741313 20010420205718 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10DD41193 20010420232458 2 6 100 4094 5 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10E0AB4EF 20010421003952 2 6 100 4094 5 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10E22F857 20010421013245 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10E31828B 20010421085157 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10EE28B2B 20010421092617 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10EE97A3B 20010421135621 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C10F52C463 20010422012438 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C110627AF3 20010422042530 2 6 100 4094 2 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C110A793B3 20010422163438 2 6 100 4094 5 65B5B9F5ECFADB4CCB38D1BC894302E95B4843290F1A7A40579DF3E2FF98C1D3DA9F210857C784433DF32ADF9E0C80121211690E1FFB41B8DB4E86AFE388A09C9BB2C98EDC581C2E65D57F61BB920C3D1B7B058B5FADFF65D607DAFF443B8BA1ACE1A3A7B16EA0713F62537C6689E3C4A0F61198F3B054FCF140CFADD8622C0E7621998331E59DA6F72E9D608D0E58F526E95F485C7CA30A416617DA3CCFF722BB82362606283D054B34B83ECDB4C91BAB835944010EBE5E9FA7B016ED89891DD553CC71B5CF76EDB2A184B377F670D6AF191763EEFD175E48EA37EE18B9E44E2D017D845C444C8111816819866E490B52F7F879A0C6F401CF7859674F93E304365F4E8CB8C312EFB725732A46D7CF0C9D2939AEE25F428CEFC90959DBF8ADD612F343EF9BFCA2FBA61BD4BF93E1E54626D227FDA812E18D071579AB4EEAC9901DAB183BCB0D9F48732D92CE66B386EAE5D8212C9FD156DC3F09B171B5603E17A468D244F3B6880EBCDA189BA9E23E4A4C6C2995ACF264F8CE9D54B27316343C0BC19221F75E6A2AC68011741695E599F73460B7A042E0461DB189CDCE223B40336BF2251AE3B363159960C9F63B47EFC43790D474DABB9A686DAF21E0DD76533749FCA9F144FA9C243CEF1364C79D981ED81DC4635C73B7F8908BA190AA920ED370F815BC2F9B3D28ED87BE34A01498836222C17B70C246C03CA1C111D2A227 SSH PRIVATE KEY FILE FORMAT 1.1  dq䶤ڢm #e5j!gS5U-[_ ۶扼O q4d1e NԢr2<+/z4Oc;d! £VgƁ>!MpJ.l~T"p#root@clonestation"cy%B !{ԏ&ZҬ<#cOy?ñW|;2yG&?u|WGAl#g63h,P/|/Kv倏[Ŋ+ֹ6<5otlZD/oVC{э $%bA1Z>fX-qG/lI.r['؞# $OpenBSD: ssh_config,v 1.15 2002/06/20 20:03:34 stevesk Exp $ # This is the ssh client system-wide configuration file. See # ssh_config(5) for more information. This file provides defaults for # users, and the values can be changed in per-user configuration files # or on the command line. # Configuration data is parsed as follows: # 1. command line options # 2. user-specific file # 3. system-wide file # Any configuration value is only changed the first time it is set. # Thus, host-specific definitions should be at the beginning of the # configuration file, and defaults at the end. # Site-wide defaults for various options # Host * # ForwardAgent no # ForwardX11 no # RhostsAuthentication no # RhostsRSAAuthentication no # RSAAuthentication yes # PasswordAuthentication yes # BatchMode no # CheckHostIP yes # StrictHostKeyChecking ask # IdentityFile ~/.ssh/identity # IdentityFile ~/.ssh/id_rsa # IdentityFile ~/.ssh/id_dsa # Port 22 # Protocol 2,1 # Cipher 3des # Ciphers aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,arcfour,aes192-cbc,aes256-cbc # EscapeChar ~ 1024 35 115156630766334839423060224687583862383633281880555447233244832014183940583745423616286812939977688132051949499291833217653235243268967210308589690200035750876593793537155552915289859934717273734715795702333513017758121374846522992202353770872273235432996800366150174340244649626731440659918320857847304331773 root@clonestation -----BEGIN RSA PRIVATE KEY----- MIICXAIBAAKBgQD2z03Pm8XV5pkjidWLc9EELhiqfYwQjn+XmpDkYYxEneiaQU1E RjOguwEsM6se60HGuX8SiXjmkswVGtEHpOHYpq43bGAop4Bn8Rd2Mo6nMy4ArD/O PgDyZKoBCWFuvXYSsFSNDqgrjvOs7ynyUyB0b+RI5FkCNtvoXBS8VIxdOQIBIwKB gQDvwhES0dYgPxhrqnesChuAZ0spRsKTvaCEpMdEQYDyMv82wxfb7GyqxEpIMjEz +nppRntxF9SINtThTUAWDeKzS8PZ/kbVvG1W5Uu6XgSWIdEORqHzE6Pzti8JR8yZ FYb4kxF4zEnY+cQ3oyebEVjTy4KAC1XHHDuFYNVWduZCowJBAP/blyuY3K7ZKeBv xvUcs++0lzgeq88+98H58en67hB5SZSZBH93TFn/jUnRJ5Wc+lKOvsPX4o+tgrzW 88YfJFsCQQD28m0GUTO2ryhg2bqvfEmoMUQra1zpmTR2NFhkjFuPTDKidNeAqJ33 mxOMc8k6txiPmn7JirSRpdTKnmgE+Kj7AkBfCGtZVgjTOrfIZAgR5hbyoimJ34Gk v53aVYW9TpLwLQyziUrQQkDuOlkMygdjdNIBaDg6HPxhQHJjZchCRhTRAkEAvoB/ /Y8ZQ8jzQ2YiTNw40jSiTWFzj6IShxJwEw0wsF9aQs8p5uh53ERuKoU01YXuYCa5 lCksNdeyyDEOajwqlQJBALGS1U/rUcWz6pvWEHIpOF6acrJp2/jAToRgfrHUDdsn qVTINcudgP3niXe5nP8GG/6q3gFnTx/nMptki2zh5MU= -----END RSA PRIVATE KEY----- ssh-rsa AAAAB3NzaC1yc2EAAAABIwAAAIEA9s9Nz5vF1eaZI4nVi3PRBC4Yqn2MEI5/l5qQ5GGMRJ3omkFNREYzoLsBLDOrHutBxrl/Eol45pLMFRrRB6Th2KauN2xgKKeAZ/EXdjKOpzMuAKw/zj4A8mSqAQlhbr12ErBUjQ6oK47zrO8p8lMgdG/kSORZAjbb6FwUvFSMXTk= root@clonestation -----BEGIN DSA PRIVATE KEY----- MIIBuwIBAAKBgQCg3PyYhB/QUDBPxhsL3Zg+nZrljmESOfGzO9kQcK24BKvgICHi 7dQ37ptFYghcKOqatFpoFBC2sauQ1GFDfsJQZzC3Gizkc2e+UXXa8+Y5uA0Tg+4P ZSKWuA9hSLBMQic0jblCtHqzIaMxfuHWGPof6GfZQZDZY36Rs23fSEPEsQIVANOk fbmtZjVDi5laod+l764XMwDnAoGAD7IZ9CSCHfav9BLo8w8P1W5L3STTo4+uMKT1 M9Sg7mklDOX5c9vqE/T5gA33v/vHlVQG5WkRiEkgr3wzkRV5NlIwL8YIs8x8hZ07 NliTfWw7IoDrKnAglf4y/PPZOYtptMPtF/Y9JfhEyhXaSrOPf3ffoJE6PL4/CRg1 75nq3hMCgYEAgwZmaTK9JOFsTHbAwHq9tlGA+zrtDFh6h9bhyuhV6X6j0OYWJSLk e2Ig8/8jdiiKxXkbwUfWaPUbXYbCjci/BmzgunqOvrUUfk/NXO35mFDx0r+gEHAK ahWI/Ga4rBs0SYUwy14CaEzLm1XRdfjBZfkzmr7RJtrdDcrHE6+TZX8CFDSmxTK0 zXQfk00Zl03HfCgymFzX -----END DSA PRIVATE KEY----- ssh-dss AAAAB3NzaC1kc3MAAACBAKDc/JiEH9BQME/GGwvdmD6dmuWOYRI58bM72RBwrbgEq+AgIeLt1Dfum0ViCFwo6pq0WmgUELaxq5DUYUN+wlBnMLcaLORzZ75Rddrz5jm4DROD7g9lIpa4D2FIsExCJzSNuUK0erMhozF+4dYY+h/oZ9lBkNljfpGzbd9IQ8SxAAAAFQDTpH25rWY1Q4uZWqHfpe+uFzMA5wAAAIAPshn0JIId9q/0EujzDw/VbkvdJNOjj64wpPUz1KDuaSUM5flz2+oT9PmADfe/+8eVVAblaRGISSCvfDORFXk2UjAvxgizzHyFnTs2WJN9bDsigOsqcCCV/jL889k5i2m0w+0X9j0l+ETKFdpKs49/d9+gkTo8vj8JGDXvmereEwAAAIEAgwZmaTK9JOFsTHbAwHq9tlGA+zrtDFh6h9bhyuhV6X6j0OYWJSLke2Ig8/8jdiiKxXkbwUfWaPUbXYbCjci/BmzgunqOvrUUfk/NXO35mFDx0r+gEHAKahWI/Ga4rBs0SYUwy14CaEzLm1XRdfjBZfkzmr7RJtrdDcrHE6+TZX8= root@clonestation # Package generated configuration file # See the sshd(8) manpage for defails # What ports, IPs and protocols we listen for Port 22 # Use these options to restrict which interfaces/protocols sshd will bind to #ListenAddress :: #ListenAddress 0.0.0.0 Protocol 2,1 # HostKeys for protocol version 1 HostKey /etc/ssh/ssh_host_key # HostKeys for protocol version 2 HostKey /etc/ssh/ssh_host_rsa_key HostKey /etc/ssh/ssh_host_dsa_key # Lifetime and size of ephemeral version 1 server key KeyRegenerationInterval 3600 ServerKeyBits 768 # Logging SyslogFacility AUTH LogLevel INFO # Authentication: LoginGraceTime 600 PermitRootLogin yes StrictModes yes RSAAuthentication yes PubkeyAuthentication yes #AuthorizedKeysFile %h/.ssh/authorized_keys # rhosts authentication should not be used RhostsAuthentication no # Don't read the user's ~/.rhosts and ~/.shosts files IgnoreRhosts yes # For this to work you will also need host keys in /etc/ssh_known_hosts RhostsRSAAuthentication no # similar for protocol version 2 HostbasedAuthentication no # Uncomment if you don't trust ~/.ssh/known_hosts for RhostsRSAAuthentication #IgnoreUserKnownHosts yes # To enable empty passwords, change to yes (NOT RECOMMENDED) PermitEmptyPasswords no # Uncomment to disable s/key passwords #ChallengeResponseAuthentication no # To disable tunneled clear text passwords, change to no here! PasswordAuthentication yes # Use PAM authentication via keyboard-interactive so PAM modules can # properly interface with the user PAMAuthenticationViaKbdInt yes # To change Kerberos options #KerberosAuthentication no #KerberosOrLocalPasswd yes #AFSTokenPassing no #KerberosTicketCleanup no # Kerberos TGT Passing does only work with the AFS kaserver #KerberosTgtPassing yes X11Forwarding no X11DisplayOffset 10 PrintMotd no #PrintLastLog no KeepAlive yes #UseLogin no #MaxStartups 10:30:60 #Banner /etc/issue.net #ReverseMappingCheck yes Subsystem sftp /usr/lib/sftp-server ### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # Many sites are behind firewalls that do not allow initiation of # connections from the outside. On these sites you have to use the # `passive' feature of FTP. If you are behind such a firewall, you # can turn this on to make Wget use passive FTP by default. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http and ftp. # They will override the value in the environment. #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off ### This file is automatically generated by update-modules" # # Please do not edit this file directly. If you want to change or add # anything please take a look at the files in /etc/modutils and read # the manpage for update-modules. # ### update-modules: start processing /etc/modutils/0keep # DO NOT MODIFY THIS FILE! # This file is not marked as conffile to make sure if you upgrade modutils # it will be restored in case some modifications have been made. # # The keep command is necessary to prevent insmod and friends from ignoring # the builtin defaults of a path-statement is encountered. Until all other # packages use the new `add path'-statement this keep-statement is essential # to keep your system working keep ### update-modules: end processing /etc/modutils/0keep ### update-modules: start processing /etc/modutils/actions # Special actions that are needed for some modules # The BTTV module does not load the tuner module automatically, # so do that in here post-install bttv insmod tuner post-remove bttv rmmod tuner ### update-modules: end processing /etc/modutils/actions ### update-modules: start processing /etc/modutils/aliases # Aliases to tell insmod/modprobe which modules to use # Uncomment the network protocols you don't want loaded: # alias net-pf-1 off # Unix # alias net-pf-2 off # IPv4 # alias net-pf-3 off # Amateur Radio AX.25 # alias net-pf-4 off # IPX # alias net-pf-5 off # DDP / appletalk # alias net-pf-6 off # Amateur Radio NET/ROM # alias net-pf-9 off # X.25 # alias net-pf-10 off # IPv6 # alias net-pf-11 off # ROSE / Amateur Radio X.25 PLP # alias net-pf-19 off # Acorn Econet alias char-major-10-175 agpgart alias char-major-10-200 tun alias char-major-81 bttv alias char-major-108 ppp_generic alias /dev/ppp ppp_generic alias tty-ldisc-3 ppp_async alias tty-ldisc-14 ppp_synctty alias ppp-compress-21 bsd_comp alias ppp-compress-24 ppp_deflate alias ppp-compress-26 ppp_deflate # Crypto modules (see http://www.kerneli.org/) alias loop-xfer-gen-0 loop_gen alias loop-xfer-3 loop_fish2 alias loop-xfer-gen-10 loop_gen alias cipher-2 des alias cipher-3 fish2 alias cipher-4 blowfish alias cipher-6 idea alias cipher-7 serp6f alias cipher-8 mars6 alias cipher-11 rc62 alias cipher-15 dfc2 alias cipher-16 rijndael alias cipher-17 rc5 ### update-modules: end processing /etc/modutils/aliases ### update-modules: start processing /etc/modutils/paths # This file contains a list of paths that modprobe should scan, # beside the once that are compiled into the modutils tools # themselves. ### update-modules: end processing /etc/modutils/paths ### update-modules: start processing /etc/modutils/ppp alias /dev/ppp ppp_generic alias char-major-108 ppp_generic alias tty-ldisc-3 ppp_async alias tty-ldisc-14 ppp_synctty alias ppp-compress-21 bsd_comp alias ppp-compress-24 ppp_deflate alias ppp-compress-26 ppp_deflate ### update-modules: end processing /etc/modutils/ppp ### update-modules: start processing /etc/modutils/setserial # # This is what I wanted to do, but logger is in /usr/bin, which isn't loaded # when the module is first loaded into the kernel at boot time! # #post-install serial /etc/init.d/setserial start | logger -p daemon.info -t "setserial-module reload" #pre-remove serial /etc/init.d/setserial stop | logger -p daemon.info -t "setserial-module uload" # alias /dev/tts serial alias /dev/tts/0 serial alias /dev/tts/1 serial alias /dev/tts/2 serial alias /dev/tts/3 serial post-install serial /etc/init.d/setserial modload > /dev/null 2> /dev/null pre-remove serial /etc/init.d/setserial modsave > /dev/null 2> /dev/null ### update-modules: end processing /etc/modutils/setserial ### update-modules: start processing /etc/modutils/arch/i386 alias parport_lowlevel parport_pc alias char-major-10-144 nvram alias binfmt-0064 binfmt_aout alias char-major-10-135 rtc ### update-modules: end processing /etc/modutils/arch/i386 # /etc/deluser.conf: `deluser' configuration. # Remove home directory and mail spool when user is removed REMOVE_HOME = 0 # Remove all files on the system owned by the user to be removed REMOVE_ALL_FILES = 0 # Backup files before removing them. This options has only an effect if # REMOVE_HOME or REMOVE_ALL_FILES is set. BACKUP = 0 #KERNEL # # This is the checksecurity script configuration file # # These configuration variables mabye set: # # CHECKSECURITY_FILTER # CHECKSECURITY_NOFINDERRORS # CHECKSECURITY_DISABLE # CHECKSECURITY_NONFSAFS # CHECKSECURITY_EMAIL # CHECKSECURITY_DEVICEFILTER # CHECKSECURITY_PATHFILTER # LOGDIR # # Each is described in it's own section below -- search for #### # as a section divider. # #### # # The CHECKSECURITY_FILTER variable is used as an argument to # "grep -vE" to filter lines from the output of the "mount" # command. # # The default is not check the following file systems: # # type proc # type msdos # type iso9660 # type ncpfs # type smbfs # type nfs # type afs # type auto (They'll typically be picked up on the nfs branch) # type ntfs # type coda (similar to afs) # type usbdevfs # type none (--bind mounts) # # floppies (i.e. /dev/fd) # anything on /mnt or /amd # # Note that behaviour for nfs/afs has changed as of release -45. We # no longer run find across nfs/afs disks; instead we simply report # afs/nfs disks that are mounted insecurely (without -onosuid|noexec,nodev). # You can disable this report by going setting the CHECKSECURITY_NONFSAFS # variable below. # # Use temp variables to build up CHECKSECURITY_FILTER, to make it # a little more readable. # CS_NFSAFS='(nfs|afs|coda)' # Uncomment the next line to get the old behaviour. #CS_NFSAFS='(nfs|afs) \(.*(nosuid|noexec).*nodev.*\)' # CS_TYPES=' type (auto|proc|msdos|fat|vfat|iso9660|usbdevfs|ncpfs|smbfs|ntfs|devpts|none|'$CS_NFSAFS')' # CS_OPTS='\(.*(nosuid|noexec).*\)' # CS_DEVS='^/dev/fd' # CS_DIRS='on /mnt' # CHECKSECURITY_FILTER="$CS_TYPES|$CS_OPTS|$CS_DEVS|$CS_DIRS" # # Clear the temporary variables # unset CS_NFSAFS CS_TYPES CS_DIRS CS_OPTS # #### # # The CHECKSECURITY_NOFINDERRORS, if set to "TRUE" (case sensitive), # redirects any errors from the find command used in checksecurity # to /dev/null. # CHECKSECURITY_NOFINDERRORS="FALSE" #### # # The CHECKSECURITY_DISABLE, if set to "TRUE" (case sensitive), # disables the running of checksecurity # CHECKSECURITY_DISABLE="FALSE" #### # # The CHECKSECURITY_NONFSAFS, if set to "TRUE" (case sensitive), # disables the message about insecurely mounted nfs/afs disks # CHECKSECURITY_NONFSAFS="FALSE" #### # # If the CHECKSECURITY_EMAIL is set, the report is mailed to the given # address. Note that if you set this, it is *assumed* that you have # /usr/bin/mail that accepts -s; the mailx package provides this; or # you can install mutt and create a link, or some other # alternative. No, I'm not going to fix it to write the appropriate # headers and use sendmail (although I'd consider patch), nor am I # going to add a {Depends|Recommends|Suggests} to the cron package. # Do not submit bugs about this unless you include the above mentioned # patch. You enabled this option -- you take responsibility. # #CHECKSECURITY_EMAIL="root" #### # # The CHECKSECURITY_DEVICEFILTER lets you tell find not to report # devices in those directories (if you choose the daily Emails, # devices like /dev/pts/?, /dev/tty?, or /dev/urandom will change # often and clutter your mailbox) Note that these directories are # still searched for suid executables. Also not that *something* must # be defined, which is why the default is "-false". # Examples: #CHECKSECURITY_DEVICEFILTER="-path /dev/*" #CHECKSECURITY_DEVICEFILTER="-path /dev/* -o -path /home/ftp/dev/*" CHECKSECURITY_DEVICEFILTER="-false" #### # The CHECKSECURITY_PATHFILTER variable lets you set a pattern of # pathnames that you don't want to check at all. You hopefully know # what you're doing if you do this :-). # Example: # CHECKSECURITY_PATHFILTER="-path /dev/rd* -o -path /var/home/ftp*" CHECKSECURITY_PATHFILTER="-false" #### # # Location of setuid file databases. Probably should # be in /var/lib/cron, but I don't want to move them now. After # the release, maybe. # LOGDIR=/var/log root:JCQFx/fECcmOc:0:0:root:/root:/bin/bash daemon:*:1:1:daemon:/usr/sbin:/bin/sh bin:*:2:2:bin:/bin:/bin/sh sys:*:3:3:sys:/dev:/bin/sh sync:*:4:100:sync:/bin:/bin/sync games:*:5:100:games:/usr/games:/bin/sh man:*:6:100:man:/var/cache/man:/bin/sh lp:*:7:7:lp:/var/spool/lpd:/bin/sh mail:*:8:8:mail:/var/mail:/bin/sh news:*:9:9:news:/var/spool/news:/bin/sh uucp:*:10:10:uucp:/var/spool/uucp:/bin/sh proxy:*:13:13:proxy:/bin:/bin/sh postgres:*:31:32:postgres:/var/lib/postgres:/bin/sh www-data:*:33:33:www-data:/var/www:/bin/sh backup:*:34:34:backup:/var/backups:/bin/sh operator:*:37:37:Operator:/var:/bin/sh list:*:38:38:SmartList:/var/list:/bin/sh irc:*:39:39:ircd:/var:/bin/sh gnats:*:41:41:Gnats Bug-Reporting System (admin):/var/lib/gnats:/bin/sh nobody:*:65534:65534:nobody:/home:/bin/sh sshd:!:100:65534::/var/run/sshd:/bin/false #################################################### # This is the configuration file for localepurge(8). # # DO NOT EDIT! # # localepurge(8) uses debconf for storing all it's # configuration. Manual entries to this file will be # irreversibly lost after upgrade or reinstallation # of localepurge. Configuration should only be done # using the command # # dpkg-reconfigure localepurge # #################################################### #################################################### # Uncommenting this string enables removal of localized # man pages based on the configuration information for # locale files defined below: #MANDELETE #################################################### # Uncommenting this string enables display of freed disk # space if localepurge has purged any superfluous data: SHOWFREEDSPACE ##################################################### # Commenting out this string disables verbose output: VERBOSE ################################################################# # It has explicitly been requested to delete *all* locale files # present on the system and this will result in the definite loss # of all locale data in "/usr/share/locale/". You should know what # you are doing or reconfigure "localepurge" as described above. ################################################################# CET // This is a sample debconf configuration file // Comments can be in C or C++ style, blank lines are ignored // This file is in a bind-8 like format. frontend { default { driver "slang"; }; driver "text" { module "/usr/lib/cdebconf/frontend/text.so"; }; driver "slang" { module "/usr/lib/cdebconf/frontend/slang.so"; }; }; database { default { driver "textdb"; // use the textdb database backend by default }; driver "textdb" { module "/usr/lib/cdebconf/db/textdb.so"; templatepath "/var/lib/cdebconf/templates"; questionpath "/var/lib/cdebconf/questions"; }; }; ;/| # /etc/adduser.conf: `adduser' configuration. # See adduser(8) and adduser.conf(5) for full documentation. # The DSHELL variable specifies the default login shell on your # system. DSHELL=/bin/bash # The DHOME variable specifies the directory containing users' home # directories. DHOME=/home # If GROUPHOMES is "yes", then the home directories will be created as # /home/groupname/user. GROUPHOMES=no # If LETTERHOMES is "yes", then the created home directories will have # an extra directory - the first letter of the user name. For example: # /home/u/user. LETTERHOMES=no # The SKEL variable specifies the directory containing "skeletal" user # files; in other words, files such as a sample .profile that will be # copied to the new user's home directory when it is created. SKEL=/etc/skel # FIRST_SYSTEM_UID to LAST_SYSTEM_UID inclusive is the range for UIDs # for dynamically allocated administrative and system accounts. FIRST_SYSTEM_UID=100 LAST_SYSTEM_UID=999 # FIRST_UID to LAST_UID inclusive is the range of UIDs of dynamically # allocated user accounts. FIRST_UID=1000 LAST_UID=29999 # The USERGROUPS variable can be either "yes" or "no". If "yes" each # created user will be given their own group to use as a default, and # their home directories will be g+s. If "no", each created user will # be placed in the group whose gid is USERS_GID (see below). USERGROUPS=yes # If USERGROUPS is "no", then USERS_GID should be the GID of the group # `users' (or the equivalent group) on your system. USERS_GID=100 # If QUOTAUSER is set, a default quota will be set from that user with # `edquota -p QUOTAUSER newuser' QUOTAUSER="" # If DIR_MODE is set, directories will be created with the specified # mode. Otherwise the default mode 0755 will be used. DIR_MODE=0755 # If SETGID_HOME is "yes" home directories for users with their own # group the setgid bit will be set. This was the default for # versions << 3.13 of adduser. Because it has some bad side effects we # no longer do this per default. If you want it nevertheless you can # still set it here. SETGID_HOME=no root:*:0: daemon:*:1: bin:*:2: sys:*:3: adm:*:4: tty:*:5: disk:*:6: lp:*:7:lp mail:*:8: news:*:9: uucp:*:10: proxy:*:13: kmem:*:15: dialout:*:20: fax:*:21: voice:*:22: cdrom:*:24: floppy:*:25: tape:*:26: sudo:*:27: audio:*:29: dip:*:30: postgres:*:32: www-data:*:33: backup:*:34: operator:*:37: list:*:38: irc:*:39: src:*:40: gnats:*:41: shadow:*:42: utmp:*:43: video:*:44: staff:*:50: games:*:60: users:*:100: nogroup:*:65534: .N ..db.255db.127db.localdb.root db.0 named.conf; ; BIND reverse data file for broadcast zone ; $TTL 604800 @ IN SOA localhost. root.localhost. ( 1 ; Serial 604800 ; Refresh 86400 ; Retry 2419200 ; Expire 604800 ) ; Negative Cache TTL ; @ IN NS localhost. ; ; BIND reverse data file for local loopback interface ; $TTL 604800 @ IN SOA localhost. root.localhost. ( 1 ; Serial 604800 ; Refresh 86400 ; Retry 2419200 ; Expire 604800 ) ; Negative Cache TTL ; @ IN NS localhost. 1.0.0 IN PTR localhost. ; ; BIND data file for local loopback interface ; $TTL 604800 @ IN SOA localhost. root.localhost. ( 1 ; Serial 604800 ; Refresh 86400 ; Retry 2419200 ; Expire 604800 ) ; Negative Cache TTL ; @ IN NS localhost. @ IN A 127.0.0.1 ; This file holds the information on root name servers needed to ; initialize cache of Internet domain name servers ; (e.g. reference this file in the "cache . " ; configuration file of BIND domain name servers). ; ; This file is made available by InterNIC registration services ; under anonymous FTP as ; file /domain/named.root ; on server FTP.RS.INTERNIC.NET ; -OR- under Gopher at RS.INTERNIC.NET ; under menu InterNIC Registration Services (NSI) ; submenu InterNIC Registration Archives ; file named.root ; ; last update: Aug 22, 1997 ; related version of root zone: 1997082200 ; ; ; formerly NS.INTERNIC.NET ; . 3600000 IN NS A.ROOT-SERVERS.NET. A.ROOT-SERVERS.NET. 3600000 A 198.41.0.4 ; ; formerly NS1.ISI.EDU ; . 3600000 NS B.ROOT-SERVERS.NET. B.ROOT-SERVERS.NET. 3600000 A 128.9.0.107 ; ; formerly C.PSI.NET ; . 3600000 NS C.ROOT-SERVERS.NET. C.ROOT-SERVERS.NET. 3600000 A 192.33.4.12 ; ; formerly TERP.UMD.EDU ; . 3600000 NS D.ROOT-SERVERS.NET. D.ROOT-SERVERS.NET. 3600000 A 128.8.10.90 ; ; formerly NS.NASA.GOV ; . 3600000 NS E.ROOT-SERVERS.NET. E.ROOT-SERVERS.NET. 3600000 A 192.203.230.10 ; ; formerly NS.ISC.ORG ; . 3600000 NS F.ROOT-SERVERS.NET. F.ROOT-SERVERS.NET. 3600000 A 192.5.5.241 ; ; formerly NS.NIC.DDN.MIL ; . 3600000 NS G.ROOT-SERVERS.NET. G.ROOT-SERVERS.NET. 3600000 A 192.112.36.4 ; ; formerly AOS.ARL.ARMY.MIL ; . 3600000 NS H.ROOT-SERVERS.NET. H.ROOT-SERVERS.NET. 3600000 A 128.63.2.53 ; ; formerly NIC.NORDU.NET ; . 3600000 NS I.ROOT-SERVERS.NET. I.ROOT-SERVERS.NET. 3600000 A 192.36.148.17 ; ; temporarily housed at NSI (InterNIC) ; . 3600000 NS J.ROOT-SERVERS.NET. J.ROOT-SERVERS.NET. 3600000 A 198.41.0.10 ; ; housed in LINX, operated by RIPE NCC ; . 3600000 NS K.ROOT-SERVERS.NET. K.ROOT-SERVERS.NET. 3600000 A 193.0.14.129 ; ; temporarily housed at ISI (IANA) ; . 3600000 NS L.ROOT-SERVERS.NET. L.ROOT-SERVERS.NET. 3600000 A 198.32.64.12 ; ; housed in Japan, operated by WIDE ; . 3600000 NS M.ROOT-SERVERS.NET. M.ROOT-SERVERS.NET. 3600000 A 202.12.27.33 ; End of File ; ; BIND reverse data file for broadcast zone ; $TTL 604800 @ IN SOA localhost. root.localhost. ( 1 ; Serial 604800 ; Refresh 86400 ; Retry 2419200 ; Expire 604800 ) ; Negative Cache TTL ; @ IN NS localhost. // This is the primary configuration file for the BIND DNS server named. // // Please read /usr/share/doc/bind/README.Debian for information on the // structure of BIND configuration files in Debian for BIND versions 8.2.1 // and later, *BEFORE* you customize this configuration file. // options { directory "/var/cache/bind"; // If there is a firewall between you and nameservers you want // to talk to, you might need to uncomment the query-source // directive below. Previous versions of BIND always asked // questions using port 53, but BIND 8.1 and later use an unprivileged // port by default. // query-source address * port 53; // If your ISP provided one or more IP addresses for stable // nameservers, you probably want to use them as forwarders. // Uncomment the following block, and insert the addresses replacing // the all-0's placeholder. // forwarders { // 0.0.0.0; // }; }; // reduce log verbosity on issues outside our control logging { category lame-servers { null; }; category cname { null; }; }; // prime the server with knowledge of the root servers zone "." { type hint; file "/etc/bind/db.root"; }; // be authoritative for the localhost forward and reverse zones, and for // broadcast zones as per RFC 1912 zone "localhost" { type master; file "/etc/bind/db.local"; }; zone "127.in-addr.arpa" { type master; file "/etc/bind/db.127"; }; zone "0.in-addr.arpa" { type master; file "/etc/bind/db.0"; }; zone "255.in-addr.arpa" { type master; file "/etc/bind/db.255"; }; // add entries for other zones below here root::11898:0:99999:7::: daemon:*:11898:0:99999:7::: bin:*:11898:0:99999:7::: sys:*:11898:0:99999:7::: sync:*:11898:0:99999:7::: games:*:11898:0:99999:7::: man:*:11898:0:99999:7::: lp:*:11898:0:99999:7::: mail:*:11898:0:99999:7::: news:*:11898:0:99999:7::: uucp:*:11898:0:99999:7::: proxy:*:11898:0:99999:7::: postgres:*:11898:0:99999:7::: www-data:*:11898:0:99999:7::: backup:*:11898:0:99999:7::: operator:*:11898:0:99999:7::: list:*:11898:0:99999:7::: irc:*:11898:0:99999:7::: gnats:*:11898:0:99999:7::: nobody:*:11898:0:99999:7::: sshd:!:11898:0:99999:7::: root:*:: daemon:*:: bin:*:: sys:*:: adm:*:: tty:*:: disk:*:: lp:*::lp mail:*:: news:*:: uucp:*:: proxy:*:: kmem:*:: dialout:*:: fax:*:: voice:*:: cdrom:*:: floppy:*:: tape:*:: sudo:*:: audio:*:: dip:*:: postgres:*:: www-data:*:: backup:*:: operator:*:: list:*:: irc:*:: src:*:: gnats:*:: shadow:*:: utmp:*:: video:*:: staff:*:: games:*:: users:*:: nogroup:*:: .N ..event.d . ..20hdparm#!/bin/sh # Copyright (c) 2000-2002 Massachusetts Institute of Technology # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or (at # your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. set -e # The APMD_DRIVE setting specifies the drive to be changed. Set # this to an empty string to disable any changes. APMD_DRIVE= # The spindown timeout is set to the value of APMD_SPINDOWN when the # computer is running on battery power. When the computer is on AC # power, the spindown timeout is disabled. The number specified here # is encoded in a complicated way. See the man page for hdparm(8) for # details. For small timeouts, numbers between 1 and 240 specify # multiples of 5 seconds. So the default value of 18 means 18*5=90 # seconds, or 1.5 minutes. APMD_SPINDOWN=18 HDPARM=/sbin/hdparm [ -x "${HDPARM}" ] || exit 0 [ "${APMD_DRIVE}" ] || exit 0 [ -b "${APMD_DRIVE}" ] || exit 0 [ "${APMD_SPINDOWN}" -gt 0 ] || exit 0 power_conserve () { # Set IDE hard disk spindown time to a short time. "${HDPARM}" -q -S "${APMD_SPINDOWN}" "${APMD_DRIVE}" || true } power_performance () { # Disable IDE hard disk spindown. "${HDPARM}" -q -S 0 "${APMD_DRIVE}" || true } choose_power () { if on_ac_power > /dev/null then power_performance else power_conserve fi } if [ "${1}" = "start" ]; then choose_power elif [ "${1}" = "resume" ] && [ "${2}" != "standby" ]; then choose_power elif [ "${1},${2}" = "change,power" ]; then choose_power elif [ "${1}" = "stop" ]; then power_performance fi exit 0 .N .. powerbtn.shevents#!/bin/sh # /etc/acpi/poweroff.sh # Initiates a shutdown when the power putton has been # pressed. /sbin/init 0 . ..powerbtn# /etc/acpid/events/powerbtn # This is called when the user presses the power button and calls # /etc/acpid/powerbtn.sh for further processing. # Optionally you can specify the placeholder %e. It will pass # through the whole kernel event message to the program you've # specified. # We need to react on "button power.*" and "button/power.*" because # of kernel changes. event=button[ /]power action=/etc/acpi/powerbtn.sh .N .. ip-down.dpeersip-up.d chap-secrets pap-secretsresolv ... . ..provider# These are the options to dial out to your default service provider. # Please customize them correctly. Only the "provider" file will be # handled by poff and pon (unless with extra command line arguments). # You usually need this if there is no PAP authentication noauth # The chat script (be sure to edit that file, too!) connect "/usr/sbin/chat -v -f /etc/chatscripts/provider" # Set up routing to go through this PPP link defaultroute # Default modem (you better replace this with /dev/ttySx!) /dev/modem # Speed 38400 # Keep modem up even if connection fails persist ...# Secrets for authentication using CHAP # client server secret IP addresses # # /etc/ppp/pap-secrets # # This is a pap-secrets file to be used with the AUTO_PPP function of # mgetty. mgetty-0.99 is preconfigured to startup pppd with the login option # which will cause pppd to consult /etc/passwd (and /etc/shadow in turn) # after a user has passed this file. Don't be disturbed therfore by the fact # that this file defines logins with any password for users. /etc/passwd # (again, /etc/shadow, too) will catch passwd mismatches. # # This file should block ALL users that should not be able to do AUTO_PPP. # AUTO_PPP bypasses the usual login program so its necessary to list all # system userids with regular passwords here. # # ATTENTION: The definitions here can allow users to login without a # password if you don't use the login option of pppd! The mgetty Debian # package already provides this option; make sure you don't change that. # INBOUND connections # Every regular user can use PPP and has to use passwords from /etc/passwd * reutel "" * # UserIDs that cannot use PPP at all. Check your /etc/passwd and add any # other accounts that should not be able to use pppd! guest reutel "*" - master reutel "*" - root reutel "*" - support reutel "*" - stats reutel "*" - # OUTBOUND connections # Here you should add your userid password to connect to your providers via # PAP. The * means that the password is to be used for ANY host you connect # to. Thus you do not have to worry about the foreign machine name. Just # replace password with your password. # If you have different providers with different passwords then you better # remove the following line. reutel * password ... ... . .. 2.4.19-pre9 . ..kernel8buildpcmcia9 modules.dep: modules.generic_string;modules.pcimap<modules.isapnpmap=modules.usbmap>modules.parportmap?modules.ieee1394map@modules.pnpbiosmap . ..driversnet . ..block+ charnet . .. eepro100.omii.osis900.o ns83820.o sundance.o  ppp_generic.o slhc.o  ppp_async.o  ppp_synctty.o  ppp_deflate.o bsd_comp.opppox.opppoe.odummy.o+tulipELF F4(UWVSt$1=`~ PuPjVƒtD$PBPVD$ V4VhF|u t)‰@v1PF|Phuh.hV`Fdut)@1PRhuh~XV`Fdut)@1jPRà u*F`Pu~dt Vd)‰@1Ph@ E=`~WF`Ph UPSVwu 1_SV`Fdut )@t&1PRh V|ut)@1PRh [^_]YÐ<UWVSDD$8PS$XPD$< u5t&hjŃu/hD$Ff>FC;\$$|f|$"tD$"PUh $TBBhT$R`fDD$PUh1ۃ t&T$PhC~T$Ph$XCXPhD$bD$LD$PD$TD$X>ft hD$^RfPD$dPh1ۃt$<D$Vs PC~D$XfdRPh`D$f tfdPhD$Xf?ftf uVjP$\PÁ" "=EShSjD$hP$hR|$4|vD$4ptot$4!EP\$8 dEPh@ 1Ҹ EЉЀDPjD$`P$`St$FD$8$T B&hFuOy}FPhMPVùEPVDPV DPF%DQh $TCCh$Ph8] $PMhBXE$$\\$0D$8T$ǁǁ1ۃ|$4|D$4Eڈ$ˆ$X|!$X|$ˆ|$4|D$4$ƁD$XfD$ZfD$Rfˆ$PS&f vfI$tfY$tf]$u ǁt hDž DžLDž$tDžDžEDX!Dž|$Džd#1[^_]<ÐUWVS|$t$1Hfh!Hfh!&D$HHfEډ؉fh!؉fh!L-fÉ OyHfh!Hf[^_]ÍvVSt$ T$D$  ‰V^IySh vtۉ[^VSt$ T$D$  T$V^IySh@ vtۉ[^UWVS|$_ho =`~G$PWhn  ǃ ǃǃǃWWhhG$Pƃt  5G(W6fEW"w,ǃǃfǃƃWf| jPUWf jPU7 tG,G,tW G,=`~EPWh ǃPf|jPU 1[^_]Ív UWVSD$ xhh LJ uhtKy} hEEhEL$ ut$WT$xL$htKy} hE`hT$tKy} hEE@@@L$$?<u!=`~fD$ PhRt&t&hT$tKy} h$?EEhL$tKy} hEph4 ? @ ?BL$BAfB hT$tKy} h?EfE [^_] ÉUWVSD$hhp ~htKy} hFt D$PhZF$?U@~htKy} hFtD$Ph&$?FF[^_]ÉUWVSl$uhE D$ƒT$fjRD$P% 9! =`~*UhCPWPUh`f9t$ˆƆjT$RD$PjT$ RD$(P{t E,E,tUt&E,=`~T$PUh |tG+,=v5=`~#,PPPUhU P[^_]YZÉUWVSD$Xh=`~xP PT$Rh@ 1 PV ? =9DP?*9EPD$$Phi F?~(P$PT$Rh 1 s1҅tRW$? =9DP(?*9EPl;EPD$(Ph G?~[^_]ÃUWVSD$11ۋxhLJ$D$nT$P\9D$@,t FD$ދFFF D$D$|$?7j h tL$9TD$(D$ [^_]YÍvUWVSD$ph )Ѕ~j?< D$9=`~USh` %/= tBt ST$(Rh  L$@SD$(Ph at&;-j EPtÅT$$SD$L$tft{`tht&k\;PUS uD$uT$$Rh {`t hk\;vPUS L$D$$PSfCtST$( 08L$$P$Ӄ?|$tjL$(Qƒ1ED$D$T$ƃ<tD$h ?fjL$(QT$$,1[^_]ÍvUWVSD$T$X hh1B,=`~PRh` PCD$PT$ B$P =`~ D$P<T$1۾?tBpt Jpt RNyы|$1۾?tBpt Jpt RNy1t"PFuDž=`~VD$Ph  1[^_]YÐUWVSL$YhA D$z@BpBB xxBxB TB(`B,dB0\B4hB<XB@A,tD_l$vhEtNy} hD$@pW0[^_]YÉUWVS$$|$ڋ@hD$!9P u t&D$|$|$1|$ Ixu5|$@Ixul$|$t!t$t$vu!9P u 1t 1[^_]UWVSt$|$T$Nh_n It~Gt89Ft ttAfWCPPUDfCG&!uNHWCPCPPUCt W1GPV[^_]ÉUWVSD$0XhP T$(@XtD$ $uL$09~ D$ D$ =`~ D$ PP|$8Wh )‰Ѓ>~ ƃL$ :a]  D$$ ?щ@ G?DT$f B B BD$ BBƒDT$BL$ tB |$Gf} D$@H|$(t&htNy} hT$$fbL$(A  )lj;~T$01B,U|$ [L$03]  D$$ ?щ@ G?DD|$01@fBD$( D$;}-AfAfAf |$0F;|ӾhT$tNy} hL$$fa|$(G  )‰Ѓ;~L$01A,Ut&j @E"Pƃu |$0Whƃ@EF FD$D$@V=`~PL$4Qh F`|$0@fFD$0D$D$(D$D$0V1;}-AfAfAf D$0G;|Ӝ]t0 F  L$T$$D$? VTT$G?BD$vhL$tNy} hD$$f`T$(B  )ȃ;~T$01B,U=`~WL$4Ph@ D$ [^_]ÍvWVS\$s8~hVC|u t)‰@1PC|PhC` u{dtSd)‰@t&1PC`PhF PPPhDS SV[^_Ív\S|9`tPh\|`hÃ~1vDh؃[ÐhÍ@}vpi_ULA6+ ) I$)0123456789:;<=>'(I$Y$]$RR)01.01eepro100.c:v1.09j-t 9/29/99 Donald Becker http://www.scyld.com/network/eepro100.html eepro100.c: $Revision: 1.36 $ 2000/11/17 Modified by Andrey V. Savochkin and others <1>eepro100: wait_for_cmd_done timeout! 2.`H@?".`h@1unknown-15unknown-14unknown-13unknown-12unknown-11DP83840Aunknown-9unknown-8i8255580c2480c240DP83840i82503i82553-Ci82553-A/BNoneeepro100<3>eepro100: cannot reserve I/O ports <3>eepro100: cannot reserve MMIO region <3>eepro100: cannot remap MMIO region %lx @ %lx Found Intel i82557 PCI Speedo, MMIO at %#lx, IRQ %d. <3>eepro100: Could not allocate ethernet device. <4>%s: Invalid EEPROM checksum %#4.4x, check settings before activating this device! OEM i82557/i82558 10/100 Ethernet<6>%s: %s, %2.2X:%2.2X, IRQ %d. RJ45 BNC AUI MII<6> Receiver lock-up bug exists -- enabling work-around. <6> Board assembly %4.4x%2.2x-%3.3d, Physical connectors present: <6> Primary interface chip %s PHY #%d. <6> Secondary interface chip %s. <6> DP83840 specific setup, setting register 23 to %4.4x. fullhalf<6> Forcing %dMbs %s-duplex operation. <3>Self test failed, status %8.8x: <3> Failure to initialize the i82557. <3> Verify that the card is a bus-master capable slot. failedpassed<6> General self-test: %s. <6> Serial sub-system self-test: %s. <6> Internal registers self-test: %s. <6> ROM checksum self-test: %s (%#8.8x). <6> Receiver lock-up workaround activated. <3> mdio_read() timed out with val = %8.8x. <3> mdio_write() timed out with val = %8.8x. <7>%s: speedo_open() irq %d. <7>%s: Done speedo_open(), status %8.8x. <7>%s: NULL cur_rx in speedo_resume(). %s: previous command stalled %s: RxAbort command stalled <7>%s: Link status change. <7>%s: Old partner %x, new %x, adv %x. <7>%s: Media control tick, status %4.4x. <7>%s: Sending a multicast list set command from a timer routine, m=%d, j=%ld, l=%ld. <7>%s: Tx ring dump, Tx queue %u / %u: <7>%s: %c%c%2d %8.8x. <7>%s: Printing Rx ring (next to receive into %u, dirty index %u). <7>%s: %c%c%c%2d %8.8x. <7>%s: freeing mc frame. <4>%s: Transmit timed out: status %4.4x %4.4x at %d/%d command %8.8x. <3>%s: incorrect tbusy state, fixed. <7> scavenge candidate %d status %4.4x. <7>%s: TX underrun, threshold adjusted. <3>out-of-sync dirty pointer, %d vs. %d, full=%d. <3>speedo_interrupt(): irq %d for unknown device. <3>%s: SMP simultaneous entry of an interrupt handler. <7>%s: interrupt status=%#4.4x. <3>%s: Too much work at interrupt, status=0x%4.4x. <7>%s: exiting interrupt, status=%#4.4x. <4>%s: can't fill rx buffer (force %d)! <7> In speedo_rx(). <7>%s: RX packet postponed! <7> speedo_rx() status %8.8x len %d. <3>%s: Ethernet frame overran the Rx buffer, status %8.8x! <3>%s: Anomalous event in speedo_rx(), status %8.8x. <3>%s: Inconsistent Rx descriptor chain. <7>%s: Shutting down ethercard, status was %4.4x. <7>%s: %d multicast blocks dropped. <7>%s: set_rx_mode %d -> %d <3>%s: Failed to allocate a setup frame. <7>%s: Constructing a setup frame at %p. CmdMCSetup frame length %d in entry %d. <6>eepro100.c: Debug level is %d. kernel_version=2.4.19-pre9using_checksums=1author=Maintainer: Andrey V. Savochkin description=Intel i82557/i82558/i82559 PCI EtherExpressPro driverlicense=GPLparm_debug=iparm_options=1-8iparm_full_duplex=1-8iparm_congenb=iparm_txfifo=iparm_rxfifo=iparm_txdmacount=iparm_rxdmacount=iparm_rx_copybreak=iparm_max_interrupt_work=iparm_multicast_filter_limit=iparm_desc_debug=debug level (0-6)parm_desc_options=Bits 0-3: tranceiver type, bit 4: full duplex, bit 5: 100Mbpsparm_desc_full_duplex=full duplex setting(s) (1)parm_desc_congenb=Enable congestion control (1)parm_desc_txfifo=Tx FIFO threshold in 4 byte units, (0-15)parm_desc_rxfifo=Rx FIFO threshold in 4 byte units, (0-15)parm_desc_txdmaccount=Tx DMA burst length; 128 - disable (0-128)parm_desc_rxdmaccount=Rx DMA burst length; 128 - disable (0-128)parm_desc_rx_copybreak=copy breakpoint for copy-only-tiny-framesparm_desc_max_interrupt_work=maximum events handled per interruptparm_desc_multicast_filter_limit=maximum number of filtered multicast addressesQP1XY"?#"A#GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.rel.rodata.modinfo.rel.fixup.rel__ex_table.comment@ + LZ )`+ % d/@/4@/>`/ : |eF @  S@EO e ^XEZ f  ihE0ErHB Pp  #*1 <I\s < \    `d@ .@wN|\D Lfn Py LtkX!|$}d# Z 5 GWa,u5)@"$   )l %(5*cJ +b@; rB         . $@ =R Xf y " P @1 0 ; &; @@A _A ~A `B P <Xq7Un|.B^w 5 U *ca +eepro100.cgcc2_compiled.versiontxfiforxfifotxdmacountrx_copybreakmax_interrupt_workmulticast_filter_limitfull_duplexoptionsdebug__module_kernel_version__module_using_checksums__module_licensespeedo_debugi82557_config_cmdi82558_config_cmdphysis_miicards_found.1290did_version.1291eepro100_init_onespeedo_found1do_eeprom_cmdmdio_readcongenbmdio_writespeedo_openspeedo_start_xmitspeedo_tx_timeoutspeedo_closespeedo_get_statsset_rx_modespeedo_ioctlspeedo_interruptspeedo_init_rx_ringspeedo_resumespeedo_timerspeedo_rx_soft_resetspeedo_show_statespeedo_purge_txreset_miispeedo_tx_buffer_gcspeedo_refill_rx_buffersspeedo_rxspeedo_refill_rx_bufnetdev_ethtool_ioctlrxdmacounteepro100_remove_oneeepro100_pci_tbl__module_pci_device_size__module_pci_device_tableeepro100_drivereepro100_init_moduleeepro100_cleanup_module__module_author__module_description__module_parm_debug__module_parm_options__module_parm_full_duplex__module_parm_congenb__module_parm_txfifo__module_parm_rxfifo__module_parm_txdmacount__module_parm_rxdmacount__module_parm_rx_copybreak__module_parm_max_interrupt_work__module_parm_multicast_filter_limit__module_parm_desc_debug__module_parm_desc_options__module_parm_desc_full_duplex__module_parm_desc_congenb__module_parm_desc_txfifo__module_parm_desc_rxfifo__module_parm_desc_txdmaccount__module_parm_desc_rxdmaccount__module_parm_desc_rx_copybreak__module_parm_desc_max_interrupt_work__module_parm_desc_multicast_filter_limitprintk_R1b7d4074pci_find_capability_Rb073eaa1pci_read_config_word_R3e5c726fpci_enable_device_R6225e990pci_set_master_R71ceaecaioport_resource_R865ebccd__request_region_R1a1a4f09iomem_resource_R9efed5af__ioremap_R9eac042aiounmap_R5fb196d4__release_region_Rd49501d4pci_alloc_consistent_R33390bf1init_etherdev_R20772929pci_free_consistent_Rb2748b28__const_udelay_Reae3dfd6__this_modulerequest_irq_R0c60f2e0__netdev_watchdog_up_Re8d8c2bfjiffies_R0da02d67add_timer_Ra19eacf8alloc_skb_R1de2b30dsoftnet_data_R00b311adcpu_raise_softirq_Rd01f3ee8kfree_R037a0cbadel_timer_Rfc62f16d__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909eth_type_trans_Rfd04827fnetif_rx_Rc8e19da1free_irq_Rf20dabd8__kfree_skb_R2dd8a99ckmalloc_R93d4cfe6unregister_netdev_Re6fb46dfpci_disable_device_Rff052e74pci_register_driver_R954e8c53pci_unregister_driver_Rf56513b9init_modulecleanup_module )/Z:[R\f]w^|_`Za`Z-bV[ZfsxZcad_d"eHfV[ZsgZhZZZ+0Z=EMUkpZZZZZGQVZZ&hAFZZaZhhZ'1;OV`jhhhh* ho t Z  Z   Z i iM V je ik i& k; L Q ZY lt  m h  Z h= hR W Zm h  Z   Z h  Z9 hR W Zh h h  Z,hAFZZhZZDMRZinZkZ.lAPl_dZulmZZ<AZZ_noopR_dZuqoopZrhl/l@mZfh{ZhhZlcpuZoopZ'QVZwZqZ/4ZV[Z oo"pFSXZj~Zn[v{ZZ_lqZZZnxstZs t+u5vl   Z- rF wO  x x !q(!6!;!ZD!iJ!i"h"!"Z"""#r3$rV$m$$$$Z%%%%%&&h;&@&Zh'h''Z''y''Z(@(N(S(Zf)h))Z)))Z *z8*_=*dh*am*dv*c*g*{*q****Z****|*+} ++}dhlptx|                 6 6ELF4( UWVSl$t$E D$FFFEFFjEPD$PEЉǃ tN@tN}NtNjEPD$PEЉjEPD$$PEЃN@F!t 7t&t &t&} t&@ @EȁtufF d fF t@u FMdescription=MII hardware support librarylicense=GPLmii_link_ok_R1fd03128mii_nway_restart_R95c735d8mii_ethtool_gset_Rbacf6e39mii_ethtool_sset_Rc5ff7075GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.text.data.bss.note.modinfo.kstrtab.rel__ksymtab.comment@!',2@ ;gHh D @ R0[  .G  Xqsth"=@.)$In1Lmii.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensemii_ethtool_gset_Rbacf6e39mii_ethtool_sset_Rc5ff7075mii_link_ok_R1fd03128mii_nway_restart_R95c735d8__module_author__module_description__kstrtab_mii_link_ok_R1fd03128__ksymtab_mii_link_ok_R1fd03128__kstrtab_mii_nway_restart_R95c735d8__ksymtab_mii_nway_restart_R95c735d8__kstrtab_mii_ethtool_gset_Rbacf6e39__ksymtab_mii_ethtool_gset_Rbacf6e39__kstrtab_mii_ethtool_sset_Rc5ff7075__ksymtab_mii_ethtool_sset_Rc5ff7075 ELF04(WVSD$|$p`jVf ftfuPWh1 %1ۍCPV0 fD_xC~[^_ÐVSt$jjh9à uVh1UD$ PjHSD$ @PjHS1҃B pqDxB~D$ $PjHS [^YÐUWVSl$M QHƀ1%QHD$YHLߍD$fT$fDUxBT$v߁[^_]YÐUWVS|$1۸w w?vtWD$P] hCvɸ1[^_]ÉUWVSD$(l$$@,D$UÃuRPUà th EUh,ƃu 'dž@U`T$hcUÃ~hD$F EXF$o\u8\$ShU u D$ ShU u cD$$džP dždž FDdždž!dždž$pdžVÃD$PjUT$' u VU&B~<w VUau VUVUYÃt|$u T$VuOF$PD$PT$RVhj1ۃx3PhC~3Ph1\V$PPhU PPhUE8UV؃[^_]ÐUWVSD$,@hD$ T$ fD$fD$D$BdD$&jD$PT$4Rǃ Nyf fhjÃjD$PT$4RUfCjD$ PT$@R@fC D$(Cf{ T$81͋BdZdZhf=tw1D f9CuQC $f;D uDD C| u`t C CD$PDPT$4Rh Ff|*uvf|uD$PT$0Rh  D$|$D$ xduT$,Rh`1D$ @dT$,RT$$Bd@%=uBlPD$0PfD$ T$ Bd@%=@uhjBlPD$8PT$tVf|$tN!1jT$$BlPD$4Pf#D$*f1D$* ;D$f|$uD$'PjT$(B\P |$'ughjT$(BlPD$8Pj"jT$8BlPD$HP hjT$(BlPD$8PhjT$8BlPD$HP T$ Bd@ tIT$,B,B,tBR7h1+D$,PhT$,B,[^_]ÉUWVSl$uh1D$^htct&jCPUTjCPUHtu1jCPU-PjCPUD${DÉD$uu |$u~h9~dt~dGFlPUh jFlPU%PjFlPUxjFlPU(jFlPU [^_]YÐUWVS|$l$jGPUxjGPUlw %@fEډ% ـɀfDˉ%ʃ@fDс fERjGPU[^_]Ð UWVSt$ D$$1 D$1ft$#D$D$ DT$T$T$L$D$Kyİ ō, K1[^_] ÉT$0pÉVST$ 0pvIy[^É UWVSD$ t$$x D$(` fD$WWf|$D$ 0DT$T$T$L$@D$KyȻ@1D$, fD$K1D$[^_] ÐUWVSD$|$ p D$$ P VV0ft$ EՉT$T$D$ @KyՉ0ft$D$(T$ E@Ky؉@K1[^_]YZÉUWVSl$t$jVUVǃ C~hjVUǃ[^_]ÃUWVS|$who WeD$PjF\PD$#PWIWWhhG$PÃ,WWWW__,jj U%U UFdPW/VpBFpdFx~|džR1[^_]YÃUWVSD$p NHʼn1ۍ~HLf|$T$LZxȉ=~PSD$ Ph CvT$[^_]YÃUWVSD$1ph@ D$dž(dždž1DŽPO׃)Ѝ@ )D(D(G ؃~ T$ T$f =~PD$Ph` [^_]YÉ UWVSD$ 11ۋphP T$dždžD$DŽl$WOՃ)Ѝ@$DD|$E ~1\$0?T$ QD$ DD$@LG'j htu$=~PD$$Ph [^_] ÉUWVST$D$D$1jhfD$sis900.c: v1.08.04 4/25/2002 (#9 9p40pkqke@X \Dc4`#01.01kernel_version=2.4.19-pre9using_checksums=1author=Jim Huang , Ollie Lho description=SiS 900 PCI Fast Ethernet driverlicense=GPLparm_multicast_filter_limit=iparm_max_interrupt_work=iparm_debug=iparm_desc_multicast_filter_limit=SiS 900/7016 maximum number of filtered multicast addressesparm_desc_max_interrupt_work=SiS 900/7016 maximum events handled per interruptparm_desc_debug=SiS 900/7016 debug level (2-4) SiS 7016 PCI Fast EthernetSiS 900 PCI Fast EthernetRealtek RTL8201 PHYNS 83851 PHYICS LAN PHYAMD 79C901 HomePNA PHYAMD 79C901 10BASE-T PHYSiS 7014 Physical Layer SolutionSiS 900 Internal MII PHY<6>%s: Error EERPOM read %x %s: Can not find ISA bridge <3>sis900.c: architecture does not support32bit PCI busmaster DMA sis900<6>%s: %s at %#lx, IRQ %d, %2.2x:%2.2x. <6>Cannot allocate mem for struct mii_phy <6>%s: %s transceiver found at address %d. <6>%s: Unknown PHY transceiver found at address %d. <6>%s: No MII transceivers found! <4>%s: reset phy and link down now <6>%s: Using transceiver found at address %d as default <6>%s: Receive Filter Addrss[%d]=%x <6>%s: TX descriptor register loaded with: %8.8x <6>%s: RX descriptor register loaded with: %8.8x <6>%s: Media Link Off fullhalf100mbps10mbps<6>%s: Media Link On %s %s-duplex <6>%s: Transmit timeout, status %8.8x %8.8x <6>%s: Queued Tx packet at %p size %d to slot %d. <6>%s: Abnormal interrupt,status %#8.8x. <6>%s: Too much work at interrupt, interrupt status = %#8.8x. <6>%s: exiting interrupt, interrupt status = 0x%#8.8x. <6>sis900_rx, cur_rx:%4.4d, dirty_rx:%4.4d status:0x%8.8x <6>%s: Corrupted packet received, buffer status = 0x%8.8x. <6>%s: NULL pointer encountered in Rx ring, skipping <6>%s: Memory squeeze,deferring packet. <6>%s: Transmit error, Tx status %8.8x. v1.08.04 4/25/2002<6>Not supported<6>Invalidp  p 5 5 p QP1XYGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.rel.fixup.rel__ex_table.comment@0$ Bx)$@ % DHp/%4%:%  G( C H8S/O H ^/Z H  i0080r|3D :> 1Jau!}$(,4T@` c(| 4dIw]hnq~P  !p+r " @3@ >TD ^X &i"v8 | Fxb$S[P'q=4EG|Z  o y`#(#@ $@D-!B V ]O/ )B^y,Jhx*A]y##@/ $sis900.cgcc2_compiled.__module_kernel_version__module_using_checksumsethernet_polynomial_leethernet_polynomialversionmax_interrupt_workmulticast_filter_limitcard_namessis900_pci_tbl__module_pci_device_size__module_pci_device_tablemii_chip_table__module_licensesis900_get_mac_addrread_eepromsis630e_get_mac_addrsis635_get_mac_addrsis962_get_mac_addrsis900_probesis900_opensis900_start_xmitsis900_closesis900_get_statssis900_set_configset_rx_modemii_ioctlsis900_tx_timeoutsis900_mii_probemdio_readsis900_default_physis900_reset_phymdio_writesis900_set_capabilitymdio_idlemdio_resetsis900_resetsis630_set_eqsis900_interruptsis900_init_rxfiltersis900_init_tx_ringsis900_init_rx_ringsis900_set_modesis900_check_modesis900_timerdebugnext_tick.1341sis900_read_modesis900_auto_negotiatesis900_rxsis900_finish_xmitnetdev_ethtool_ioctlsis900_compute_hashtable_indexsis900_removesis900_pci_driversis900_init_modulesis900_cleanup_module__module_author__module_description__module_parm_multicast_filter_limit__module_parm_max_interrupt_work__module_parm_debug__module_parm_desc_multicast_filter_limit__module_parm_desc_max_interrupt_work__module_parm_desc_debugprintk_R1b7d4074pci_find_device_R2f35dc0fpci_read_config_byte_Rede9d9d2pci_write_config_byte_R57220483__const_udelay_Reae3dfd6pci_enable_device_R6225e990pci_set_dma_mask_R98ebc076pci_set_master_R71ceaecaalloc_etherdev_Rd50ed31a__this_modulepci_request_regions_R02896321pci_alloc_consistent_R33390bf1register_netdev_Rc1644cbeunregister_netdev_Re6fb46dfpci_free_consistent_Rb2748b28pci_release_regions_R2f79544ckfree_R037a0cbajiffies_R0da02d67kmalloc_R93d4cfe6schedule_timeout_R17d59d01__netdev_watchdog_up_Re8d8c2bfrequest_irq_R0c60f2e0add_timer_Ra19eacf8alloc_skb_R1de2b30d__kfree_skb_R2dd8a99csoftnet_data_R00b311adcpu_raise_softirq_Rd01f3ee8__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909eth_type_trans_Rfd04827fnetif_rx_Rc8e19da1del_timer_Rfc62f16dfree_irq_Rf20dabd8pci_register_driver_R954e8c53pci_unregister_driver_Rf56513b9init_modulecleanup_module* /LwM LNOOPQ   R' ,L7SAT^Uj pVWW *4>NXhN L L L%YAZ]Zm[v\] ^Ym L L! &L_]N` L L Ls N  a ] # b~   Lap uLtc L M"NN8]` LN] b L4 9 I N [ `L LdSe\ehft]c]l L  L $La| L L$ )L\gzhij]c Lc L L5e=eIfeefHkRl~dd< M \  q  v L  LI!N!0#N}#\#Z#Z#Y#\#[##L##m$$n!$&$n, 0          ; ;ELF$4(WVST$t$L$\$(rzL$zL$ zL$$BZ R,[^_ÐWVS\$K S^{,# …E‰SVh![^_WVS\$C SYs,# …E‰SQh![^_ÍvUWVS|$l$ ̀G D$D$t&O 3T$^_,# EWVWWD$|$ vWY_,# ƒ|$E‰WQ[^_]YZUWVSl$1UM U[u,# …E‰USD$PU1ۃUE׋#EE t4 UCvɋM U[u,# …E‰US[^_]ÐÍvUWVS)ЍP?OЃ)ЃQD$D$ȃ)‰Ѓ{F)B?O$)ƒ$CptKpS <t F?fD$@BB D$B 9tF??,t&D$|$?w+j h Ãtt$t&[^_]YZÐUWVSƋopD$ t؃ DT$T$|$t)G( ЉG(B8 B8B, F`t@u @t: t5B(%? B(B8%B8B,$B,D$xف%@ʁ@Eʉl$l$d$l$d$ @|$Eȉt1@t O%` 艆Etu94tm1F,F,t.F,u[F851Sgb|$EPT$PVh$t94t1F,Vh4[^_]YZÉUWVSt$džfdžfdž1ҍv@@ D$@B?v΋@4B0)B?O$)ƒ1D$cvD$vу)ȉʉsD$G)B?O$)ƒ%Cpt Kpt S <t G?fD$@BB D$B 9tG??,1t$D$|$?w5hh Ãt&1|$E؅ǀ@H@H@HdžXʲB!P@1tEP0f9uVh v[^_]YZÍvWVSt$ZHRdž11ۋP@4@0t&DŽ@@ D$@tBpt Jpt RG?v[^_ÉSÃk1tCP0f9uSh t7)ЍP?OЃ)Ѓ0~PY1tJP0f9uSh &[É UWVSǍD$D$T$ >t&@ D$D$ T$A?fD$@@ D$@{`t hs\;v PVS tMthHPD$*tD$TuCkCkWSfCtS u#`Cpt Kpt SD$T$h} D$f t$[^_] S\$@@ B[ÉUWVSl$@t\tL%TH t,Ipt"[  1St&G?f@FD$D`9t FXE,tmD@҃)ЍP?OЃ)Ѓ~D1E,E,t4E,u%[E8-1S[^_]ÍvWVSt$11>HDŽ>HtBpt Jpt RC?vƋ`1<[^_Ð UWVSl$8D$D$T$4@D$(t1E,D@D$$T$$C)ƒ?J;T$(M,@;D$$tM,F9uD$C?fF+T$( M,D$T$4 |$(EȉL$ D$,zku4D$,B P uD$, "ED$,D$,T$4r\|$(t+r`L$4D$@D$`T$HL$`C?dzD$,B D$( u1ɸ |$E@ ;T$E J1҅t1/|$(t2L$ QP,D$@qL$ L$(eT$4D$L$A AfD|$t3@;T$$t&D)B?O$)ƒ~u,1[^_] ÍvSL$C`%XCd%xCh%Cl%|CpStppCx%‰pC|%[ÉS\$ShH[ÁUWVS$$!9P |$u vD$D$t |$1|$ u|$@u$vu!9P t$u1󥍶upzD$D$D$ @} t$F t$F!9P u󥍶t t&1[^_]ËD$Ph|$ FuD$@PReøÍvD$PÉVS\$ǃptǃzt-$B1u7t6t t tt @ +dfBf?vShfǃBDf9Bt ǃ<D$Df9Btt&ƀt SRt S@tG[^VSt$ \$u[^ÉS\$@@@ǃhS?SS1[ÉWVSt$@<VÃuv`1ۍ`SЃ?dӃ?v܋dfdžBfdž@@$P 1<F, V؃[^_VSt$ L$1ۍt&BHC@LAAv[^ÐT$ D$P`1ÉÉSD$1ɋH@Yt 0 @Yt ! ȉ[ÍvUWVS|$h(þr0,ǃ@ǃShd PWƃtVhWo|jhU dPhW`PhWP`C;B@@ǃjjjjjPPSShhGXPƃ0tGXPhSǃǃǃ8CD0ǃ ǃǃ_8hSB@ sxB uB B uB t'Sh@uSh % tdShB, B, `ǀǀǃ4@PBXt  t&@(2Ћ@@@@8@<ǀǀ@D@@VS@tSh  !&DPGXPUC}PC|PC{PCzPCyPCxP@X%P@XPSh@14_PdP`PhWPPhW WSG8[^_]ÍvVSt$ ^8@@@SS@XPPdP`PhP PPhPPSF8[^ÉShh`Ã~1Dh`؃[h`ÉUWVSt$)ЍP?OЃ)Ѓ[D$у)ȉʉsD$G)B?O$)ƒ+Cpt Kpt S <t G?fD$@BB D$B 9tG??,1t$udescription=National Semiconductor DP83820 10/100/1000 driverlicense=GPLns83820.c<7>%s: uh-oh: next_rx == next_empty??? 1000F1000(?)100010010fullhalf<6>%s: link now %s mbps, %s duplex and up. <6>%s: link now down. ns838200.17<1>%s: BUG -- txdp out of range <6>ns83820: pci_enable_dev: %d <6>ns83820: unable to register irq %d %s: detected 64 bit PCI data bus. %s: EEPROM did not enable 64 bit bus. Disabled. %s: enabling optical transceiver <6>%s: using 64 bit addressing. h,sgsg<6>%s: ns83820 v0.17: DP83820 v%u.%u: %02x:%02x:%02x:%02x:%02x:%02x io=0x%08lx irq=%d f=%s <6>ns83820.c: National Semiconductor DP83820 10/100/1000 driver. QP1XY&(GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.comment@ 2)@ % <6P/4: C O# K 6 Z$V 60 e$0H$n`'p/ , 2K,\hq  d : 5 _8i0H|  ))7GtSt&dZq~7MH8`(@  )B \OsP@Ap(1BZv)E^r:Mk@*>@ns83820.cgcc2_compiled.__module_kernel_version__module_using_checksumsrx_refill_atomicspeeds.1314phy_intrns83820_setup_rxns83820_cleanup_rxns83820_rx_kickrx_irqrx_actiondo_tx_donens83820_cleanup_txns83820_hard_start_xmitns83820_update_statsns83820_get_statsns83820_ethtool_ioctlns83820_ioctlns83820_mib_isrns83820_irqns83820_do_resetns83820_stopns83820_openns83820_getmacns83820_change_mtuns83820_set_multicastns83820_init_onequeue_refillns83820_remove_onens83820_pci_tbldriverns83820_initns83820_exit__module_license__module_pci_device_size__module_pci_device_tablesetup_ee_mem_bitbangereeprom_clk_lo__const_udelay_Reae3dfd6eeprom_clk_hieeprom_send_addreeprom_readweeprom_writeb__kfree_skb_R2dd8a99calloc_skb_R1de2b30dsoftnet_data_R00b311adcpu_raise_softirq_Rd01f3ee8printk_R1b7d4074schedule_task_R2d6c3d04__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909eth_type_trans_Rfd04827fnetif_rx_Rc8e19da1__tasklet_schedule_Red5c73bfschedule_R4292364calloc_etherdev_Rd50ed31a__this_moduletasklet_init_Ra5808bbfpci_enable_device_R6225e990pci_set_master_R71ceaeca__ioremap_R9eac042apci_alloc_consistent_R33390bf1request_irq_R0c60f2e0register_netdev_Rc1644cbeiounmap_R5fb196d4pci_free_consistent_Rb2748b28pci_disable_device_Rff052e74kfree_R037a0cbaunregister_netdev_Re6fb46dffree_irq_Rf20dabd8pci_register_driver_R954e8c53pci_unregister_driver_Rf56513b9__module_author__module_descriptioninit_modulecleanup_module11/250|03206 7[8d8p9w |  : :6L 7 : 6  :J ;  :o <  = > ? 6 8 8 9 8 8 9 6   c@ :AVBCDE :FGH H/I :J  FAaA : : : :! & q v:KLLMNO.P:KYL{LMN :QRR6 Z7 :     h lpt  ELFh,4(UWVSD$0xD$,Pt&T$,Rt$0vXt$ hD$(u D$ ǀ@hgT$0Rst$,tv|jPVD$$ 61D$$D$FPT$RHT$(fDrxF~t$r D$jhB$DxHT$,t$VhR ED$$VhD$4P ]ED$$T$ ǂdǂX ǂLBD4ǂǂXǂ$ ǂt$,V8tB`D$ PƃT$TRPD$(Php\$ xvPhF~T$RPh1ƅ1 jVD$(Pà t:t6/jVD$(PfPSVT$8GRh F~|ut$F0PD$$Ph hɀhi <Zʀh\$2ެuu1 t=ެuu1 uDžldt$?uu1 tt$Juu1 uDžldt$Luu1 tt$Vuu1 uDžl Z&t$Xuu1 tt$buu1 uDžl }h ʀhT$B0}htDžld $hhjPt$,VQ+hpAshjPD$,Phug ldEЀDPjPT$,RhidEPlPh =~t$F0PhD$f@2=~T$B0Ph1wPEPht$8VPEPhD$8PT$,B8t$VD$,PT$ R[^_]ÍvL$fD$fA6A6f}J1A4ÐT$IyÐUWVSD$|$1X D$^  S&EՈ Iy I[^_]ÐWVSD$t$X D$^ P t$S4E׈ IyI[^_ÐUWVS|$ohw WWhh@ G$Pà =~G$PWh WF,D$WxDTC~(uh$G(1DžpW fFLfFFdF _,fFLfFR =~-FPPFRPFPPFFPF PWhDž0Dž,,48Dž< D$P1[^_]YÉUWVSl$]h} jPU!h €t=uGP ~&1u %@uh9tR$ˆh=t'QPRMEPUh`1 fEfGP[^_]VS\$ shS =~!B PBFPBLPShS4,P[^ÉUWVS|$o whEFPWh PhW1ۃDPhiC~FPhp1ۃFDPhC~hG(fELGPhu8G,t.G,u[G8=1S[^_]à UWVSD$ 1xhLJ`LJLLJdLJPhL$ Q` y`G‰TGD$T$D$t&U Oփ)Ћ DD L$DF݃~1GT$ PQD$@LTL E1j TPtT$uPL$1vWDE~[^_] ÍvUWVSl$]hD$`KQD$@Q@\ A \t `\P`+dv h1E,U Bu BEP=~W`PUh1[^_]ÍvUWVSD$,D$ P T$ph?D$t D$ PT$T$d$K\$T$ BF؍&=~SD$$Ph  tL؃tttt t T$fB2D$f@RT$fBFBFOtd9`VDtl</Jpt[  1S/dPd9`tVDuhtZd`)‰ЃwEhT$ 1B,t.B,u[B81S|$tD$PT$$Ry\$}QD$ P=~#T$BJPD$PT$(Rh@D$f@Lf@f@L@GT$BND$D$%fBN=~D$PT$$Rh |$z=~T$BNPD$$Ph [^_]Ív UWVSD$ @hD$T$LD$d$P)L$=0T$DP\$Sh D$@=~Vh@D$%t T$t L$t \$t T$kVL$$QhSt&=~D$PSh ;j CPƒtՅL$ JL$D$tftz`th&Z\;vhPSR Vt&|$t$,7}`t h]\;v?PSU 7\$ SUfEtUCT T$LHLȃD$\$D$fx},p=~VhL$T$P9LփL$P\$<3ukj TPt3T$ PYD$D$D$@LT$L$T$T\ DPPP9L31[^_] ÐUWVS|$l$_ wh@t/=~WhfCLfCfCLfCN@h~jPW2jPW !Wh! th75} hM*t&@t hct& t hx t&hajPWà ځ dfEPWh RMfEPhW} WtUWh [^_]SD$X HhCy CpCrCuSvЉSwЉCtCxxB~SlCn‰ShCj‰[ÍvUWVSD$(L$(@ D$QXt.QhT$T$L$(;t$T$T$t&T$1D$(1틀D$T$tsL$(;}gt&t$Fxt&1Ȩt Ky}҃?T$\$E\$t |$(;|&D$@\"T$1j\$fDk`E~K\[^_]ÁUWVS$$|$ڋhh!9P u t&D$u|$|$$1|$gu|$8u|$xvu!9P t$u 1t 1[^_]ÉSL$T$ D$Z=I=GtGX=Ft,=t? =t#=tTBPQAh$ƒfCPPQsfC1 Kt&!u0HCPCPPQ1[ÍvUWVSl$1] }hE,=~HCNPC PCFPUh PPLPdP`PUh` ,fCLfCR@,GD$D$=Ph 1GD PGDPGDPVh F~ϋPh 1D PDPDPVh F~UE$PS \$1DDߺt!Bpt Jpt RF~\$t!Bpt Jpt RNy1[^_]YZWVS|$w8tV^hVPPhWPCPhW$WF PV G8[^_Sh hÃ~1Dh؃[hÉ <6>sundance.c:v1.01b 17-Jan-2002 Written by Donald Becker <6> http://www.scyld.com/network/sundance.html @@@ g01.01kernel_version=2.4.19-pre9using_checksums=1author=Donald Becker description=Sundance Alta Ethernet driverlicense=GPLparm_max_interrupt_work=iparm_mtu=iparm_debug=iparm_rx_copybreak=iparm_media=1-8sparm_desc_max_interrupt_work=Sundance Alta maximum events handled per interruptparm_desc_mtu=Sundance Alta MTU (all boards)parm_desc_debug=Sundance Alta debug level (0-5)parm_desc_rx_copybreak=Sundance Alta copy breakpoint for copy-only-tiny-frames Sundance Technology AltaD-Link DL10050-based FAST Ethernet AdapterD-Link DFE-530TXS FAST Ethernet AdapterD-Link DFE-580TX 4 port Server AdapterD-Link DFE-550FX 100Mbps Fiber-optics AdapterD-Link DFE-550TX FAST Ethernet Adaptersundance<6>%s: %s at 0x%lx, %2.2x:%2.2x, IRQ %d. <6>%s: MII PHY found at address %d, status 0x%4.4x advertising %4.4x. <6>%s: No MII transceiver found!, ASIC status %x 100mbps_fd4100mbps_hd310mbps_fd210mbps_hd1FullHalf<6>Override speed=%d, %s duplex ASIC Control is %x. ASIC Control is now %x. <7>%s: netdev_open() irq %d. <7>%s: Done netdev_open(), status: Rx %x Tx %x MAC Control %x, %4.4x %4.4x. fullhalf<6>%s: Setting %s-duplex based on MII #%d negotiated capability %4.4x. <7>%s: Media selection timer tick, intr status %4.4x, Tx %x Rx %x. <4>%s: Transmit timed out, status %2.2x, resetting... <7> Rx ring %p: %8.8x <7> Tx ring %p: %4.4x <7>%s: Transmit frame #%d queued in slot %d. <7>%s: Interrupt, status %4.4x. %s: Transmit status is %2.2x. <4>%s: Too much work at interrupt, status=0x%4.4x / 0x%4.4x. <7>%s: exiting interrupt, status=%#4.4x. <7> In netdev_rx(), entry %d status %4.4x. <7> netdev_rx() status was %8.8x. <7> netdev_rx() Rx error was %8.8x. <4>%s: Oversized Ethernet frame, status %8.8x. <7> netdev_rx() normal Rx pkt length %d, bogus_cnt %d. %s: Turning interrupts back on. <6>%s: Link changed: 100Mbps, full duplex 100Mbps, half duplex 10Mbps, full duplex 10Mbps, half duplex <6>%s: Link changed: %dMbps ,%s duplex. <3>%s: Something Wicked happened! %4.4x. <5>%s: Promiscuous mode enabled. 1.01b<7>%s: Shutting down ethercard, status was Tx %2.2x Rx %4.4x Int %2.2x. <7>%s: Queue pointers were Tx %d / %d, Rx %d / %d. <7> Tx ring at %8.8x: #%d desc. %4.4x %8.8x %8.8x. <7> Rx ring %8.8x: <7> #%d desc. %4.4x %4.4x %8.8x QP1XY35GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.comment@ x;X)  % AX/@ 4:` C`!@ O+K (B Z+V 8B  e+0+n/5 5e !4Kc|   l PT-/9dFEX NL[4elqX~ d wL@   ^td  2hC(S@a o@(*    P0-G0`O-GXq ">Rn *J@Vsundance.cgcc2_compiled.debugmax_interrupt_workmulticast_filter_limit__module_kernel_version__module_using_checksumsethernet_polynomial_leethernet_polynomialversion__module_licensesundance_pci_tbl__module_pci_device_size__module_pci_device_tablepci_id_tblcard_idx.1284sundance_probe1eeprom_readnetdev_openstart_txnetdev_closeget_statsset_rx_modenetdev_ioctltx_timeoutmtumdio_readmediamdio_writemii_preamble_requiredmdio_syncintr_handlerinit_ringnetdev_timercheck_duplexnetdev_rxnetdev_errorrx_copybreaknetdev_ethtool_ioctlsundance_remove1sundance_driversundance_initsundance_exit__module_author__module_description__module_parm_max_interrupt_work__module_parm_mtu__module_parm_debug__module_parm_rx_copybreak__module_parm_media__module_parm_desc_max_interrupt_work__module_parm_desc_mtu__module_parm_desc_debug__module_parm_desc_rx_copybreakpci_enable_device_R6225e990pci_set_master_R71ceaecaalloc_etherdev_Rd50ed31a__this_modulepci_request_regions_R02896321__ioremap_R9eac042apci_alloc_consistent_R33390bf1register_netdev_Rc1644cbeprintk_R1b7d4074__const_udelay_Reae3dfd6pci_free_consistent_Rb2748b28iounmap_R5fb196d4pci_release_regions_R2f79544ckfree_R037a0cbarequest_irq_R0c60f2e0jiffies_R0da02d67add_timer_Ra19eacf8softnet_data_R00b311adcpu_raise_softirq_Rd01f3ee8alloc_skb_R1de2b30d__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909eth_type_trans_Rfd04827fnetif_rx_Rc8e19da1free_irq_Rf20dabd8del_timer_Rfc62f16d__kfree_skb_R2dd8a99cunregister_netdev_Re6fb46dfpci_register_driver_R954e8c53pci_unregister_driver_Rf56513b9init_modulecleanup_module@6AKBnCs }DE )FQFwG H H3 8H H H  5 f     " I' , > CHL\ aHt HJJKLM}N H-U ZHbOP< M  R  ^  c H   H O P  H  H  $ H6  ; HR  W He  j Hy O Q Q R S O *  / HM    HQQRQQ+Ra H H HRq vH H  H"0 5H>OSTUT;CUXVbWgO HS HH MHZ e v   H H   H# (H HQ   e H H H $H9 >Hc hH{XYZZ+[@JVJ_LhKnMH\]]PT |       - -ELFJ4(!uÀH1ÍvSD$ X\tE@\;u;C@u S95K0t!t t S5S91[Ív4UWVSD$H!@\D$ D$$D$(D$,D$0|$(D$4|$8D$<D$@u t$ \$4$ډ\$\$ t$ZE19t ƋKXFFRt$u?T$ D$z<u-D$HD$@uD$u 닍!T$D$tXD$F\;D$Pw(D$PPD$TP uV\T$FptT$Jpt VD$[^_]4ÉUWVSD$|$ p\u D$hF4PÃF4D$WD$ P{`tht&/{\;vPWS U tCpt KptRSGFZCH@KXRtt&VNV|$D$[^_]YÐSL$T$ Y\u1>C$tt RPQ C19CESEEȉ {<Eȉ[Ã,UWVSt$D\$LF\D$ D$uST$LRVjt&|$HtD$ PRK'!O\y@\$ 9P u A81ۉvD$  1D$ RG+tA0O\D$ 1\t&uMD$ R+t@0G\D$  ux}1 vD$ D$ [^_YÍvhh@hjl tPh 1ÃUWVSD$ T$@hD$Bt=t=t6=tv=7t=݆t 1L$TpD$t h\$C|)ljj T$$BfC\PÃ.L$ Afʼn|$W\{`t hS\;vsPRS D$@\tftT$Bpt Jpt L$Q\$\$C\;C|sPjS |$D$QT$ 1B,D$ZGH@Ox9RL$Q14t&\$Cpt Kpt |$WD$1[^_]YZÉD$@hÍvUWVS$$$hhD$RT$ t tDt$hVU"!T$L9P ؅|$xt$ى1򃽈tRR@ЃtT$@RQ@4Ѓ!T$P9P u|$1ED$D$AG1۹׉IAPRD$P E\$\$ t&D$D$[^_]ĤÐD$f@f@`ǀd @Dǀƀǀf@df@X1UWVSt$VV~Y19t%‹KXBBt&QtRVt&uI9~EFu>B,t.B,u[B81S u xQ,[^_]ÃUWVS\$ |$QЉD$=AC\;C|sPjS $tN PRS u8Ght2h`CptKpS,t(PRS t C\vC\;C`s h=C\|$!t|$fmlcG\Yj @fC\Pƃu h@fT$G\4PD$PPC\PRGlPT$,ōA9u(FptNpVt&} D$-$ D$/ACpt Kpt S󋳄U{`t hS\;vPRS t$D$T$P jSW  GacV|$!H|$:j BfB`PƃuhVfxfv@f@`PC\PPPPBЉŃ\Cpt Kpt S{`tht&k\;vPUS C\v:C\;C`s h=Fpt Npt VG]t5 w@GZCH@KXRG$2W.!Cpt Kpt S[^_]YZÐVSt$ FDVD9tvF]ubBt@SRRЃt'Cpt Kpt Sdž u?xT'3SV/t%džCpt Kpt S[^Ã4UWVSD$HL$LD$@P\@D$,DD$,T$HD$,D$HDRDT$ 9tht&\$ Ü{ CpD$@f{pu5D$ \$HDD$ \$9t*؍T$ B \$ 9uD$ D$ 9u|$@u1LT$$I\L$<:u BT$$IL$%L$ApL$@\$s\;v:PVS G=D$H@]@t‹$D$0GG*L$0OT$HGGGt$$|$,tftT$BHPSPЃuZL$KAA CYR\$CqD$Hl$$)l$<D$0)l$(|$( u x#|$<L$4T$HD uxn#\$HCht hD$H[^_]4UWVSl$}H|EǃvZ19t%ƋOxFFt&REHPVPЃuZ^C^p3Reu[}vY19t%‹KXBBt&QtBpt JptR뭺H u z4"u-E`t P u x"[^_]ÃUWVSD$\$xt{\u(CptKpRSDt&@G`t GZCH@KXRƍG$D$ vbYE19t$‹NpBBt&QӅt'CptKptS wD$Nt WSP Cpt Kpt S u x  ux &[^_]YÉVSD$ X{`tzj jƒthB\D$B,C`tSRPX "&Bpt Jpt R u x u x [^ÐSL$ \$A\v4@ƒ=uD$PQST :QST.tApt Ipt QS[ÍvD$@lt PÐUWVSD$\$t‹Bd% = u SR$ÃQ4/ -t#vL$QlA\ {`u)lj1{j C\PD$t|$u htD$S\x`t hL$Q\;v PRQ C\tftCpt Kpt SD$\$PlC\PPR h t&S\9v>)Љƒ{`t hS\;v!PRS(9sl9vh{`uC\QjPS C|$WlG\ C\PAPR h@!jSD$ P T$C\+t/ !t)t3AWt 91D$ZCH@KXRƋL$l$$y vaY19t!ЋNr@@QÅt+CptKptSD$x w&C\;C|s}#PjS L$$tP PRS u:|$Ght h`CptKp*SD$,t(PRS tT$C\vC\;C`s h=L$@Xtƒ| pt!CptKpSC\vC\;C`s h=|$CfCtC$SBT%Cpt Kpt SD$P[^_]YÐUWVS\$l$@2j EXPƃtuh'&EXPPC\PPPB,Љǃ}-uMfFptNpVCpt Kpt S{`t h{\;v2&PWS C\vWC\;C`sh=3&z0t C\PPPB0Ѓ Mf@U؃[^_]ÃUWVSl$t$U\EȍA9F\tPPXP P ӉŠBF,F\9w)ȉF\;F`s h=ʉ~,}4t)HF\;F|s'PjV ! É)؉9~ \&)9~K)^lD$ Xt+y&Fpt Npt VUDED|$9tNjB)HZ9u)yVU{D$xv,Pl)y&VUIU|ƃu)t&Fpt Npt VU[^_]YÉVSt$D$ ^l9t+BlyBFr0NA[^ÉUWVSD$,L$,T$$D$ D$D$D$u+1t&\$CpD$D$`\$WvT$,D$&D$$t$$D$)FMC,}D$D$K\L$|$@,T$,9D$~ L$Qh U9(j D$PtD$ D$,h`T$,NC,$@EF;\$ t7+Sl)yVRh ڐt&9+t$$|$L$,Gl9t)AhtHPRh D$,P;|$tyT$;to+L$S\y`t hvL$:Q\;v URQ C\tftD$;uT$JlT$,AD$8T$ 9tPL$ ICCCBCpt Kpt SD$ 9uD$[^_]ÉWVS\$hjxƃu 1F`^HsjVC F4FtVLFLFTBB FlPЉF8$F@BV@@$$, ux}t& 1[^_ÐD$@uË@8ÍvD$Pt+R`tB8t& u z!VSD$ X@CLCH u ~S SDC@P u xC<C$K0t S(   [^ÐD$@t PÍvPUWVSl$dt$h!D$ 9P |$Tȅu t&1tD$X wPD$XPD$

tSSjF8PhF<F@F$  [^_UWVSl$ U1[^_ÍvWVS|$ ,<uWh_wY19t ‹KXBBQt)BptJpt&R뫐t&Y19t%‹NpBBt&QtBpt JptRW[^_áu ,t hh_hjlt hÍvWVSt$\$t3 w#u C t&!ƍC u1[^_à UWVSl$ ]t D$$T$$T$d$L$$L$d$1hhƒ#׉Z tS &Ӌ D$$w]et$$T$k <*u0hhƒ#1ZL$)|$(us|$/ L$(T$C t S v|${[^_] ÃUWVSD$1D$u 1t&|$1t 3G)փv0T$Bu ZD$\$C룍vD$! ՅtD$ u t&D$g&[^_]YÉVSt$ tE8t.1҃x uH Bw<tw  XP؅u[^QRZYfJQYPQRZYX.PQRZYX2PQRZYX,PQRZYX4PQRZYXPQRZYXPQRZYX& 2PQRZYXsPQRZYXPQRZYXPQRZYXPQRZYX`PQRZYXPQRZYXPQRZYXPQRZYX:PQRZYXAPQRZYXPQRZYXPQRZYXsPQRZYXQYPQRZYXfJ QYPQRZYXPQRZYXPQRZYXPQRZYXPQRZYXPQRZYXPQRZYXDPQRZYXPQRZYXPQRZYXPQRZYXPQRZYXDPQRZYXH $$x t 01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL!W+)݆7<7>PPPIOCDETACH file->f_count=%d <3>PPP: not interface or channel?? <3>PPP: no memory (VJ compressor) <6>PPP generic driver version 2.4.2 ppp<3>failed to register PPP device (%d) 2.4.2<7>PPP: outbound frame not passed <3>PPP: no memory (VJ comp pkt) <3>PPP: no memory (comp pkt) <3>PPP: no memory (fragment) <3>PPP: no memory (VJ decomp) <7>PPP: VJ decompression error <3>PPP: VJ uncompressed error <7>PPP: inbound frame not passed <3>ppp_decompress_frame: no memory <3>ppp_mp_reconstruct bad seq %u < %u <7>PPP: reconstructed packet is too long (%d) <7>PPP: no memory for reconstructed packet<7> missed pkts %u..%u ppp-compress-%dC0p0e1e1`0`0e1e1e1e1e1e1e1e11ppp%d<3>PPP: couldn't register device %s (%d) <3>ppp: destroying ppp struct %p but dead=%d n_channels=%d ! <3>ppp: destroying undead channel %p ! <3>PPP: removing module but units remain! <3>PPP: failed to unregister PPP device FQP1XY QP1XY8 I QP1XYT. H& 6: >K NXV.`ppp_register_channel_R7d1dac95ppp_unregister_channel_R0d752837ppp_channel_index_R951919b0ppp_unit_number_R092e9e14ppp_input_R90a6cedappp_input_error_R2b04c806ppp_output_wakeup_Reb06c97bppp_register_compressor_R9682e733ppp_unregister_compressor_Ra1b928dfall_ppp_units_Rf6e9a5cfall_channels_R532ea23fGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.rel.fixup.rel__ex_table.kstrtab.rel__ksymtab.comment@@ d )A % px/A 4A:A9GB@ C \qxS@GpO qP ^GPZ $r iH vIXr rI0JM K W~ 6O[j|$, U|5D6:*x3=TNH_ Tht@r md8h9=l1  .`37 7r@H-:d "I Woe2sLL/v,u&S%(>(( ;45EI\2l|2)<P;H;(;M=Z- /B^'4KVi~%3?M$ @Vpx*AYl,,,<8-.(A02Pc20  $ @) ;M8 a  !  A , ]P t w   (  0D "p 8 $ @ D H< \] Pppp_generic.cgcc2_compiled.__module_kernel_version__module_using_checksumsall_ppp_semppp_unit_countall_channels_lockall_channels_R532ea23fnew_channelschannel_countnpindex_to_protonpindex_to_ethertypeppp_openppp_releaseppp_shutdown_interfaceppp_destroy_interfaceppp_destroy_channelppp_readppp_writeppp_xmit_processppp_channel_pushppp_pollppp_ioctlppp_unattached_ioctlppp_connect_channelppp_disconnect_channel.text.lock.ppp_genericppp_ccp_closedppp_set_compressppp_create_interfaceppp_find_unitppp_find_channelppp_device_fopsdevfs_handleppp_start_xmitppp_net_statsppp_net_ioctlppp_get_statsppp_net_initppp_pushppp_send_frameppp_ccp_peekppp_mp_explodeppp_receive_frameppp_receive_mp_frameppp_receive_nonmp_frameppp_receive_errorppp_decompress_frameppp_mp_insertppp_mp_reconstructinit_ppp_filelast_channel_indexfind_compressorcompressor_listcompressor_list_lockfind_comp_entryall_ppp_units_Rf6e9a5cfcardmap_find_first_freecardmap_getcardmap_setppp_cleanupcardmap_destroy__module_licenseadd_wait_queue_Rd278756eschedule_R4292364cremove_wait_queue_Ra3eb339d__generic_copy_to_user_Rd523fdd3__kfree_skb_R2dd8a99calloc_skb_R1de2b30d__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909__generic_copy_from_user_R116166aa__pollwait_Rbfbd9e0cprintk_R1b7d4074__get_user_4rwsem_down_read_failedrwsem_wakeirq_stat_R903e93e1do_softirq_Rf0a529b7jiffies_R0da02d67slhc_init_R2e0e927fslhc_free_R2894cfb0softnet_data_R00b311adcpu_raise_softirq_Rd01f3ee8kmalloc_R93d4cfe6sk_chk_filter_R53c0767ckfree_R037a0cba__down_failed__up_wakeup__this_moduleppp_initregister_chrdev_R8c0e3e1cskb_under_panic_Rf4c660d4sk_run_filter_Rda4ad3aaslhc_compress_R76135e6c__wake_up_R2c77a2afppp_input_R90a6cedappp_input_error_R2b04c806slhc_toss_Rf89e3455slhc_uncompress_R3bc1319e___pskb_trim_R0870c3f3slhc_remember_R0bc55868netif_rx_Rc8e19da1ppp_register_channel_R7d1dac95ppp_channel_index_R951919b0ppp_unit_number_R092e9e14ppp_unregister_channel_R0d752837rwsem_down_write_failedppp_output_wakeup_Reb06c97bsprintf_R1d26aa98request_module_R27e4dc04ppp_register_compressor_R9682e733ppp_unregister_compressor_Ra1b928dfrtnl_lock_Rc7a4fbedregister_netdevice_R1594fa50rtnl_unlock_R6e720ff2dev_close_R21da4722unregister_netdevice_R9595e0b9unregister_chrdev_Rc192d491init_modulecleanup_module__kstrtab_ppp_register_channel_R7d1dac95__ksymtab_ppp_register_channel_R7d1dac95__kstrtab_ppp_unregister_channel_R0d752837__ksymtab_ppp_unregister_channel_R0d752837__kstrtab_ppp_channel_index_R951919b0__ksymtab_ppp_channel_index_R951919b0__kstrtab_ppp_unit_number_R092e9e14__ksymtab_ppp_unit_number_R092e9e14__kstrtab_ppp_input_R90a6ceda__ksymtab_ppp_input_R90a6ceda__kstrtab_ppp_input_error_R2b04c806__ksymtab_ppp_input_error_R2b04c806__kstrtab_ppp_output_wakeup_Reb06c97b__ksymtab_ppp_output_wakeup_Reb06c97b__kstrtab_ppp_register_compressor_R9682e733__ksymtab_ppp_register_compressor_R9682e733__kstrtab_ppp_unregister_compressor_Ra1b928df__ksymtab_ppp_unregister_compressor_Ra1b928df__kstrtab_all_ppp_units_Rf6e9a5cf__ksymtab_all_ppp_units_Rf6e9a5cf__kstrtab_all_channels_R532ea23f__ksymtab_all_channels_R532ea23fKtLMNO8PxQRSOCTU6VUVV YY*Y0YFYVV[x[V\ U"Y(Y9]HYNYdY ^ ^ _ ` S a b Y Y b/ Y5 YK Yg Vq Y Y Y Vh Vu }   V Y Y Y% * U2 7 > gK P UY PQQowROhlON&0^YcY^!^-_7YhiUOi![DQPj@OOQR2P@EUOQ R2QTOkOY,O>YDYOKYdYjYPQ6>R"Y(YTYZY{UYOYYYYYY ODYOkY4O<YBYSYYYYYPYOYYYOny P  Q  R2!OW!oc!!Q!!R!p "q""U2#OP#ky##h#i##U#O $i$[<$Q$O$Q$$r$[$OH%Ph%m%U%O%O&Q.&6&RV&QS'Q''h'O(O **U3*Pc*h*U**U**U+9+Q\+R+O,`|,Y,,,,,,,Y,Y,e,e-Y!-Y'-Ye-Yq-Yw-Y-Y-Y-k-e-e.S..y.z4/YU/Y[/Y/Y/Y/Y?0t1Yz1Y1Y1Y1Y 22$2R2`c2q2w22b}3`3`3333{444y4}4~444444U45b"5b555Y5Y5Y5Y5Y5}5556+6k66N6f6k6U6]6O:7O7O7b7b7b7778"8(848<8B8X8v8~88Y8Y8Y8Y 9Y9Y&9Y<9YT9v9Y9Y9Y9Y9Y9Y9Y9Y9Y:):.:U:O:O:b; ;;;U ;-;4;@;E;U;`X<`=b=W=X>Z>Z(>Z8>ZH>ZX>Zh>Zu>c>d>Z>Z>Z>Z>Z>Z>Z>Z ?Z?Z,?ZtutftD$ȈFF F F N |$~;fNf~i ILTfFi؉C$FPV  1[^_]ÍvS\$t5t PCt PS  [ËT$L$Af=vBfJ BÐT$ff ÍvT$u R%É,UWVST$@B iȴ t$,ˋifD$*t$ t$|$HrD$Dx t T$@B\@ĩ?tL$@AC&t$D$T$֊V ЋT$HD$$9 F $<tL$@At$@mF T$DE9B uE9Bu t$E9t"9uыD$@M@$T$@B L$9t9u t$@F ECAEiED$EL$DT$T$f9~UA@@9hE8A\t$U(F f8@$<v΃}0 fvt$Ã}p D$@ t"@PT$$RD$(L$2L$t$Af9FT$L$BA)tPt$$VXD$(L$2D$T$p΋B)t&ZPL$$QD$(L$2D$T$XˋB)t&PL$$QD$(L$2D$*wr$Tvt$DE f9F;D$$tK9uBE +D$$9u1D$fD$* D$ E +D$$9uT$fD$*T$ L$DAE )ÃtPt$$V-D$(L$2 D$P D$* fDD$*T$L$DfD$*BEAUBABA B ABT$L$BABAB A BA\$ +\$|$Tt T$@E8B t3D$LL$PT$*@L$LEAT$@L$ EB vD$LL$PT$*@D$ L$ fAL$ |$ t$tftD$H|$ t$D+D$$t$$tftt$@FT$L؀ )T$ D$ L$DUEABABA B ABt$T$FBFBF B FB$<v$}0΃tftL$A ffv$}p΃tftt$@EF FL$H|$Lt$DD$HtftL$LT$P EA pD$H[^_],ÃUWVSt$$D$(D$F,|$, F01T$(:BT$@uF t4F41hL$(QL$EF 99f V F iVЉD$ŃD$\$SeЃІfE$U ˆU L$U A$D$ tt&FT$BċU+D$ʉUUL$UA+T$ʉUt"M SƒHІfEe t"SƒEІfEt S~ƒEȉEt SVƒEȉE t(S.ƒL$AІfAT$B@fBD$\$,+D$()k\$؆ċL$fAfA |$(t$+L$|$9s AD$(T$L$(D$σBABAB A BA|$$<v6t$0tftT$$DD$T$L$($‹v"AAA AIJufЃЋL$(fA T$EEBEBE B EB|$|$E ffv8t$ptftT$E DD$vF0V[^_]ÃUWVSl$|$$ E8st&T$ $D$w E8U&L$ Y A L$ D$v"QQQ QIHufƒftE<:] vE0Ut&] iشe t$ ]SKCFBFBF B FBD$D$CBABAB A BA|$v#t$ D${0tftC(ffv+T$L$ {pttftC(D$E(D$$[^_]YZÍvD$tH 1Ð1ÐT$tB4PB0PB(PB,PhÉS\$t/CPCPCPCPhC$PC Ph [Éh@1Í&01.01kernel_version=2.4.19-pre9using_checksums=1license=Dual BSD/GPL<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value 88888888888 %d Cmp, %d Uncmp, %d Bad, %d Tossed %d Cmp, %d Uncmp, %d AsIs, %d NotTCP %10d Searches, %10d Misses <6>CSLIP: code copyright 1989 Regents of the University of California slhc_init_R2e0e927fslhc_free_R2894cfb0slhc_remember_R0bc55868slhc_compress_R76135e6cslhc_uncompress_R3bc1319eslhc_toss_Rf89e3455GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.data.bss.note.modinfo.rel.rodata.kstrtab.rel__ksymtab.comment@  d% + 0 6 BC@ ? ,KXh0T ` b0k t/H+OV"  ]- nMP@  t $ &2C< :Q o   (  @ / QX u  r ( x  slhc.cgcc2_compiled.__module_kernel_version__module_using_checksumsencodepull16decode__module_licenseslhc_init_R2e0e927f__this_modulekmalloc_R93d4cfe6kfree_R037a0cbaslhc_free_R2894cfb0slhc_compress_R76135e6cslhc_uncompress_R3bc1319eslhc_toss_Rf89e3455slhc_remember_R0bc55868slhc_i_statusprintk_R1b7d4074slhc_o_status__kstrtab_slhc_init_R2e0e927f__ksymtab_slhc_init_R2e0e927f__kstrtab_slhc_free_R2894cfb0__ksymtab_slhc_free_R2894cfb0__kstrtab_slhc_remember_R0bc55868__ksymtab_slhc_remember_R0bc55868__kstrtab_slhc_compress_R76135e6c__ksymtab_slhc_compress_R76135e6c__kstrtab_slhc_uncompress_R3bc1319e__ksymtab_slhc_uncompress_R3bc1319e__kstrtab_slhc_toss_Rf89e3455__ksymtab_slhc_toss_Rf89e3455init_modulecleanup_module R)2;Aaqz e  -  2 V  [ h  m y  ~ TX\`dhlptx|  "$ $&(,(ELF4(D$ t@lÉT$Jlt JpBpPÐUWVSt$ hhŃ1huEE E,`E@EXE\EhElEpEtUxExE|BBDžDžPÃu 1U  [^_]ÍvSD$ ǀ Klu KpKp1PSdtBpt Jpt RSLtBpt Jpt RS  [ÉÉÉUWVS\$ t$$D$Pǃu ` TwTT 7tt(wTt&Vtt>v!9P ȅuO1ۍP:!9P ȅu1ۍP1D|&VS\$$SD$$PFw WVST$$RL$$QŃ<&!9P ؅u1ɉ1ۅD &W[^_]YÉ1ÐÉVSt$ VÃt_D$PD$PD$PS u xSN1ttVЃ[^ÐVS\$ SƸt%VYtPV[^ÍvSh jÃtSh [Ã$UWVSD$8T$<D$Ot @wuB~udɜ@ۿRdv!0&gv4DUJüXџn|ك1 w.fT@R+:dN_vm|$ÿ6H ;Z*^lO}~l .ǟ䩐 2ZLKy^hh ?z.ĕ*8FkzTHYb- UQP1XY >@( 2W<DTppp<3>PPP_async: error %d registering line disc. <3>PPPasync: no memory (input pkt) <3>failed to unregister PPP line discipline ppp_crc16_table_R58d54d4bGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.fixup.rel__ex_table.rodata.kstrtab.rel__ksymtab.comment@ d%h)@` % '`/4: G`^C ,(HRHN t( ]  ern )|$0T*   4MW hr( A` ~0$   y7hIl[twph Il ~ @ 8( 8 @`-@Q#/=On~"7Sp` 0Le|8(`ppp_async.cgcc2_compiled.__module_kernel_version__module_using_checksumsflag_time__module_licenseasync_opsppp_async_sendppp_async_ioctldisc_data_lockap_getap_put.text.lock.ppp_asyncppp_asynctty_openppp_asynctty_closeppp_asynctty_readppp_asynctty_writeppp_asynctty_ioctlppp_async_flush_outputppp_asynctty_pollppp_asynctty_roomppp_asynctty_receiveppp_async_inputppp_asynctty_wakeupppp_async_pushppp_ldiscppp_async_initppp_async_encodeasync_lcp_peekppp_async_cleanup__module_parm_flag_time__module_parm_desc_flag_time__up_wakeup__this_modulekmalloc_R93d4cfe6ppp_register_channel_R7d1dac95kfree_R037a0cba__down_failedppp_unregister_channel_R0d752837__kfree_skb_R2dd8a99cppp_channel_index_R951919b0ppp_unit_number_R092e9e14n_tty_ioctl_R29c4fd08irq_stat_R903e93e1do_softirq_Rf0a529b7ppp_output_wakeup_Reb06c97btty_register_ldisc_Rcfcab920printk_R1b7d4074__get_user_4ppp_crc16_table_R58d54d4b__kstrtab_ppp_crc16_table_R58d54d4b__ksymtab_ppp_crc16_table_R58d54d4bjiffies_R0da02d67alloc_skb_R1de2b30dppp_input_error_R2b04c806__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909___pskb_trim_R0870c3f3skb_under_panic_Rf4c660d4ppp_input_R90a6cedainit_modulecleanup_module:-@-U./0--_2330--456777"9:A:P!U;L<e7s7y7<<<@@C== 3 7d 7j 7 3 7 7 7 37 7= 7\ 9 ACB`CzD%3~=EC(1FuG3B!;B=e:q!v;,188888$!04@DHPTX\$.8@PZ  $(,048<@D=>ELFH4(WVSL$t$\$K~/t&F8AЃ8K[^_ÍvVSL$ t$\$ t&FB<^v. A%u%AK[^Ív,UWVSD$@l$Dt$HtVPh ~F\$t& ߸ jUS)jUD$ppp_synctty: %s, count = %d <7>%s pppsync<3>PPP_sync: error %d registering line disc. send bufferreceive buffer<3>PPPsync: no memory (input pkt) <3>failed to unregister Sync PPP line discipline LNeQP1XY NP(2g<DTGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.comment@ H) ` % `/4:9C  O^K X H Z`HV  e0n@* 06OXd Wflu~IL=@TvpP ~  , mBxP|^wol ~F > @D(HX-   )HXf-JWsD(Xppp_synctty.cgcc2_compiled.__module_kernel_version__module_using_checksumssync_opsppp_sync_sendppp_sync_ioctlhex.1146ppp_print_hexppp_print_charppp_print_bufferdisc_data_locksp_getsp_put.text.lock.ppp_syncttyppp_sync_openppp_sync_closeppp_sync_readppp_sync_writeppp_synctty_ioctlppp_sync_flush_outputppp_sync_pollppp_sync_roomppp_sync_receiveppp_sync_inputppp_sync_wakeupppp_sync_pushppp_sync_ldiscppp_sync_initppp_sync_txmungeppp_sync_cleanup__module_licenseprintk_R1b7d4074__up_wakeup__this_modulekmalloc_R93d4cfe6ppp_register_channel_R7d1dac95kfree_R037a0cba__down_failedppp_unregister_channel_R0d752837__kfree_skb_R2dd8a99cppp_channel_index_R951919b0ppp_unit_number_R092e9e14n_tty_ioctl_R29c4fd08irq_stat_R903e93e1do_softirq_Rf0a529b7ppp_output_wakeup_Reb06c97btty_register_ldisc_Rcfcab920__get_user_4__out_of_line_bug_R8b0fd3c5alloc_skb_R1de2b30dskb_over_panic_Ra9587909skb_under_panic_Rf4c660d4jiffies_R0da02d67ppp_input_error_R2b04c806ppp_input_R90a6cedainit_modulecleanup_module**).*z,,-.2/;,A,122/,,345666/8FM9\a*\:u666:)::;<+ 2i ;  = 2  >& ?N  6 6J 2t 6 6 2 6 6$ 2A 6G 6` 8  <  * @S ;l t = ; >"A<2J@]9in*w+077777$04@DHPTX\$.8@PZ  $(,048<@DELFy4( S\$L$ T$D$PRjjjjQS [ÐUWVSl$\$|$$T$0D$t8u|$48t tRED؅} D$ߋD$(Hw(|$ u!~| |$,||$,~ JhjE(PE Љƃ u'u.D$F~(F$HF,L$(NHFDHFLT$( %VPjF$PE(PE ЉF0jF$PE(PE ЉF8jFDPE(PE ЉFAB8u6AB8u.;L$s(AB8u AB8uAB8uAB8uAB8tD$)Ⱥ)‰9~oh;\$$}-TT$3D$T$D$!,B;l$ v L$()Gl9w[^_]ÃUWVSl$]$MlU4Ed))‰uu uu ~E$9rp}04;tft}DE<)]h)]d)]T4xډT$1f)9fCfOuE8ߍ4x1f)9fCfOuT$MytVREdE0ElPQElEl v!}0EduP8U@D1#ULU@}lw Ex[^_]YWVS\$|$C 9GSlKTSdSdClt9r@)‰SlCdj)P| C01PSCdCTP]xSTKdC$)9r0jQ|C01PSCdCTPxtv{lTS{lAtUPSTCd)P|C0 &1PSCdCTPPuE1DЉ[^_ÉUWVS|$1v:OPW@wdG0_8D01‹G<#WLW@#w,,Pf,s_@W<GdfZt'WdG$)9wt UWGXGXPGhWd)‰PWD$GXWl)‰Wl ;Gxwdv_HGXt&GdHOdOPW@pG0_8D01‹G<#WLW@#w,,Pf,s_@W<GdfZGXPWXuGdPGXw0_PGdGdGX0W@D1#WLW@ G0WdPjWD$OlGd |$tNPV@NdF0^8D1‹F<#VLV@#N,PT$fKN@V<FdfJVXFhVpF\FX|$t`;Vxs[VdF$+T$9wHtD$PV FXFXw&tuFhVd)‰=vFXNp9NXVdFlxAPF\@)RVVlŋFpB)‰VlFp vFdPVd9w;NPV@F0N8D1‹F<#VLV@#^,PT$fYN@V<FdfJFpPVpuFdF`FXPVdjЋVT)P| F0t&1PVFdFTP][~`t`FdV0DPjV t0jVTFd)P|F01PVFdFTPFdNlxu1F`FdNlFl=VFl=w|$tą~`tFdV0DPjVF` |$PVTFd)P|F01PVFdFTPVPu|$E&|$DЉ[^_]YÉ$UWVS=11D$D$1ҽ ~  GKuF~Ѹ T811@n~  GKu~X@E~&<㍇ &@GKu~D$t&fIy1۸"fCfD$$~ D$&"f Cf@~fD$& D$""fCf@~fD$"D$$"fCf@~fD$$D$Phh 1ۃ 1fdžjSfC~[^_]$ÉS\$ǃ ǃ   ǃ$ 4t ( ǃ0 HfǃǃǃS[ÉST$fIyt  t&fIyCHfIyfǂǂǂǂǂ[Ív UWVST$ D$(\$(L$ T ۋD$H9T$́P9}0D${|$4|$$ f9r u )8.w\$t$ D$|$$T f9r)u T$)8*v|$( T$ \$(ۋH9~D$ |$L$(T <[^_] Ð0UWVSD$H(PT$<@L$8pt$4PT$0@L$DD$,D$DD$(4 L$R fNyt$DT LfDLGT$<D$D$$T$DDp;t$,~t$,D$(ft;\$<QL$$1fq;\$0| L$4+D$02t$DL|$8tt$8DȋD$DG<u|$(D$\$,ۋt$,L$(NfuSPC [^_ÐUWVS|$l$ t$0VUD$0Ph`hhWT$8Rà u}u8u F`!tVT$,PFVD$(PT$4Rh`hjD$0PT$8Pà uD$$8uev]u F4uVT$0PFt FVT$,P؃ &1[^_]ÐT$+D$ ÁVS=D$D$,(TD$0D$D$4\$Dt$ $Iy A~A~؍t&A~Vhhh`hhh SI CtIyVhhh`hjjS $$$$1[^ļÍvVSt$\$ 1҅t)t&CSډÅuZRF(PF$Љڃu1[^ÉD$jjP(R@ Љƒ t"D$BD$BD$ BD$BÐUWVSD$(T$,L$,p T$IT$(L$@ D$ jZ0B,9)؍x&D$ L$(A iT$,BD$+BL$ D$(X0T$0RL$0QPT$ D$(P hL$,AD$+AD$T$(Z0L$0QD$0PL$ T$(J jD$,@T$,D$+BL$ D$(X0T$0RL$0QPuT$ D$(P hL$,AD$+AD$T$(Z0L$0QD$0P6L$ T$(J jT$D$,PL$,D$+AD$T$(Z0L$0QD$0PL$ T$(J jT$D$,PL$,D$+AD$T$(Z0L$0QD$0PL$ T$(J jT$D$,PL$,D$+AD$T$(Z0L$0QD$0PpT$(z()ߋ &$T|$ D$ L$(A iL$T$,JD$+BD$T$(Z0L$,QRFPFPFPFPD$HD$DT$DL$@D$4RT$0I D$@L$8T$(hX0B,9s)؍x L$(y()߃|$0t |$0D‰FF FFF D$9s5|$%T$D$0L$ D$ BT$;l$r̋T$D$ #VJl$ )uBFt&tFBFut&@M t Y L$,A!T$ D$(P hD$AD$+AT$L$(Y0jD$0PQxVT$9s8t&|$eL$D$0L$ D$ D$;l$r͋D$ T$)#Fl$ FF FFF D$9s9t&|$5T$D$0L$ D$ BT$;l$r̋T$D$ #VJl$ )tFBF @uF BF  L$,A=T$ D$(P hD$AD$+AT$L$(Y0jD$0PQ,t&VT$9s8t&|$L$D$0L$ D$ D$;l$r͋D$ T$)#F l$ D$(+P$F 9s)ЋT$(J()L$\$)D$~D$(@(D$9u!T$(B,R$9t9s)؍x|$)߅upL$(Y0D$0PT$0RQL$4D$< Y0A,9s )؍xA( T$(B()9u#L$(Q,I$L$9t9s)ڍz)߅T$D$0OL$(BT$C;Q(uA$D$FPVL$(I(L$9u!T$(B,R$9t9s)؍x|$)߅upL$(Y0D$0PT$0RQL$4D$< Y0A,9s )؍xA( T$(B()9u#L$(Q,I$L$9t9s)ڍz)߅D$0FCOzD$(X0T$0RL$0QPD$zfree: header corrupted (%x %x) at %p <3>z_compress: deflate returned %d <7>z_decompress%d: short pkt (%d) <7>z_decompress%d: bad seq # %d, expected %d <7>z_decompress%d: inflate returned %d (%s) <7>z_decompress%d: ran out of mru <7>z_decompress%d: didn't get proto <7>z_incomp%d: inflateIncomp returned %d (%s) <6>PPP Deflate Compression module registered GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.comment@l  )m % 0 /p 4p:pBG q@ C Е O`y0yX| R 66O@xc RrLT  ,Y8 hL  t@xL   )47xDHShw t x xg2!0V8"\#$3 @3]*2382dA-;PLW|^`|exl`xsXLR~(T dB,e/\e`e*efj~ ~ 8(a'u,'=HI ^*?n,xH4YL;4RJ54;v56X<J Vn Y UbbbccbUbcUbcb)c\b 3bmCh{;$P$^&&((4))*e*++_+++-C-V--.//60J0004e4g5f5Y5i5f5d5hD6 6 6 7 8 -8lQ8m8em9 9 9Y2:o^:q#;d;s;t;tI<eQ= ?t!?t? u@u@v@ BwuC D D DxEyFyFtG /GwGtHzHv I{3IsAItKItIwJwJexPtR RtR S %S PS dStkS S S S StS S Tt7TFT]TTTTT T .U8U=UBU GU WUdUsUUU^X X}YyZ ZyZyP[ [yu\w_]w]w^w`yNayaybyb byb c d d e ee"e |$(t7L$MhchP |$GHuW1/D$@HT$PjL$J|$zB D$[^_] ÉT$D$jPR ÍvT$D$jPRg ÍvL$D$|$ u,8u'xu!P<u:Q u |$t#yHu1út&AHfPJQJt &ALfDALfDsD$A A|$tA QPÍvVSt$ \$L$T$D$ jPRQSV2[^VSt$ \$L$T$D$$jPRQSV [^Ã@UWVST$XBRЉD$<=v1L$TD$TT$T\$\ IL$L@D$HR HD$0D$`T$DT$dD$@D$,9N‰D$dt)L$XCACCT$TCfBCBCD$`|$`D$XO+L$DL$$D$HD$&T$XL$LOT$7҉D$PPP BSD Compression module registered GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.comment@0   ) @ % h / 4 : BG  C @ O0XX   3L/V0`8oyOXn((8 - ,<J\p %  % bsd_comp.cgcc2_compiled.__module_kernel_version__module_using_checksumsbsd_clearbsd_checkbsd_comp_statsbsd_resetbsd_freebsd_allocbsd_comp_allocbsd_decomp_allocbsd_initbsd_comp_initbsd_decomp_initbsd_compressbsd_incompbsd_decompressppp_bsd_compress__module_licensevfree_R2fd1d81ckfree_R037a0cba__this_modulekmalloc_R93d4cfe6__vmalloc_R79995c5bprintk_R1b7d4074bsdcomp_initppp_register_compressor_R9682e733bsdcomp_cleanupppp_unregister_compressor_Ra1b928dfinit_modulecleanup_module1AJP0 GMp ot!6   !  !  !  !  #  !  %  $(,04 ELF4(D$vÐ< uD$  1Í&ÉD$w  ÉS\$C tPC $C [Ív UWVSD$ Xl$(D${0tS&C0 u xk|$$7tulD$C D$VD$!9p ЅuD$1ɉEu=D$C C +xtUT$(Rt$(V@ЉD$$ tS&C0s4C89C8t u xD$[^_] ÐS\$D$ v3&uSЉƒu C@ [ÉhÉjPQRZYXPQRZYXlt&01.01kernel_version=2.4.19-pre9using_checksums=1author=Michal Ostrowski description=PPP over Ethernet driver (generic socket layer)license=GPLregister_pppox_proto_R565ba654unregister_pppox_proto_Re0ff7a18pppox_unbind_sock_R87cd5881FGGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.kstrtab.rel__ksymtab.rel.fixup.rel__ex_table.comment@ )% /4: C` P@L 0 ^X Z  ide  tl0}  + 0I O_[[  lJy@P  FH"l%>g  ! A  2E[p@P @1<pppox.cgcc2_compiled.__module_kernel_version__module_using_checksumsprotopppox_ioctl.text.lock.pppoxpppox_createpppox_proto_familypppox_initpppox_exit__module_licenseregister_pppox_proto_R565ba654__this_moduleunregister_pppox_proto_Re0ff7a18pppox_unbind_sock_R87cd5881ppp_unregister_channel_R0d752837__kstrtab_register_pppox_proto_R565ba654__ksymtab_register_pppox_proto_R565ba654__kstrtab_unregister_pppox_proto_Re0ff7a18__ksymtab_unregister_pppox_proto_Re0ff7a18__kstrtab_pppox_unbind_sock_R87cd5881__ksymtab_pppox_unbind_sock_R87cd5881irq_stat_R903e93e1__lock_sock_Rfa4c40bbdo_softirq_Rf0a529b7ppp_channel_index_R951919b0__release_sock_R2c995a40__wake_up_R2c77a2afsock_register_Re9474f25sock_unregister_R2394a062init_modulecleanup_module__module_author__module_description$.T^d"#""%p"&'"6AF(S)_$o$  ELF4(UWVSl$|$D$114;t& 0D$B~C~1ۍv 0D$CvD$[^_]YÉUWVSl$UD$P R t&1B(;D$ur*utӉ[^_]ÐUWVS\$C*PC(P/D$L$ t?k(t&1f9j(ur*{*ut %R uɋT$ C 1[^_]YÍvUWVSD$PD$P j R t.1B(;D$u|$r*ut΋B E[^_]ÐUWVSl$u 1ɿ D$AL$.9j$ZC(B$H u z{0tSC0 uxmt&C t/St UC SЃt SC0s4C89C8t u xK(t S L$R &L$ u x[^_]YZËD$T$ tw t  u RE1ÍvWVSt$\$F t7C\v#C\;C`sh=&SQ]F QFAHPRƃtF@( u x-F@  C\v!C\;C`sh=t&SFPFPCx;F@tVB1PBPS t/9C\v/{`uC\vjPS uZ&CxCs ǃFPFTZCH@KXRuC\PVЍt&16VJ(t RCpt Kpt S[^_ÍvVSt$ F PF$PRƒtB@( ux^u"Fpt Npt V\Z{0t1u01&VSƃK(t S[^ÍvVSt$ F xumPF$PRƒt B@(v u xt)Z{0u C SK(t SFpt Npt V1[^ËD$t P  ÍvUWVSt$1 jhjà u SVFƃfC$ǃ$CCC fǃǃ(hj`ljuS󫋃X^1[^_]ÍvUWVSl$u#t VF f{(t+S(C*PR u x S$tt RC$Ɔdž FD u x E^TY19t$‹KXBBt&QtBpt JptRN(t V1[^_]ÍvUWVSD$X{0tS&C0 u x D$ D$xD$C tT$ fzaD$C t|$ fCD$f}(tdSU(E*PRj u x` U$t RD$]C D$ fxPD$D$E$@Xt$ }(u D$U) uz &D$T$BfE ]EUD$uqC |$ GfC t SvC0s4C89C8t ux. D$*U$t RE$zt&[^_]YZÐ$UWVSD$8\$@fD$D$@|$(|$t&1D L$A A !9P T$]@uft&D$fD$fx@xBRHPRƒtB@( u xtFRJ(t RT$1B B L$A t A $A 1[^_] à UWVSD$ puF u D$D$D$F fD$~0t VF0 u xx$D$GfG`9D$()hjT$0GfD PVÃu D$GfʼnS {ClfCtdT$({`t hS\;vPRS T$(RT$(ERRPD$ }Cpt KptQSFD$(D$Pj*PhdWSЃD$ED$fED$fEStV&F0^4F89F8t ux>D$[^_] ÃUWVST$$l$(@$D$E|)E\D$B D$D$B fD$E\fD$|$tD$PfB9j L$D6PtÅ2T$BfljU\{`t hS\;v~PRS E\tft j UÃC\;C|sPjS D$D$fBfCtdC L$KD$PjT$,*PhdQSS|)Ept Mpt U &1[^_]ÉD$T$RPÍvWVSD$|$HT$ D$ A t D$ xD$ PЃ@PRQÃ|$ |WGtLD$ C PVPGPD$ |t$ Cpt Kpt SD$ [^_YÐUWVSD$h D$PƉ1 tft&C0PC/PC.PC-PC,PC+PC*PC(Ph`D$<Pǃ(;|$ }1|$D$ D$$9[ uuE~ u xD$ T$L$+D$ );t$$Ot$$1N[^_]YÐShjÃuAhhh` Pjh t@ [Ðjhhh`PhPQRZYX^PQRZYXPQRZYXPQRZYXIPQRZYXPQRZYXPQRZYX_PQRZYX PQRZYXOPQRZYXPQRZYXPQRZYX1PQRZYXPQRZYXgPQRZYXPQRZYXPQRZYX'&Hddc801.01kernel_version=2.4.19-pre9using_checksums=1author=Michal Ostrowski description=PPP over Ethernet driverlicense=GPLpppoe.cId Address Device %08X %02X:%02X:%02X:%02X:%02X:%02X %8s pppoe QP1fXY P1fX GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.comment@ )h)  % // 4 :@ C O-K / ZV /0 e0n0P " 0IUebo @dSHgH)` d8    0E[wt|%=Til%D=! w/IXw j `T($8Rl]j4&?Zw [1M|<Xy [|<@1%pppoe.cgcc2_compiled.__module_kernel_version__module_using_checksumspppoe_debugpppoe_hash_lockhash_itemitem_hash_table__get_item__set_item__delete_itempppoe_flush_dev.text.lock.pppoepppoe_device_eventpppoe_notifierpppoe_rcvpppoe_disc_rcvpppoe_create__module_licenseirq_stat_R903e93e1do_softirq_Rf0a529b7__lock_sock_Rfa4c40bbpppox_unbind_sock_R87cd5881netdev_finish_unregister_R4e0b74a2__release_sock_R2c995a40__wake_up_R2c77a2afsk_free_R2e231f58pppoe_rcv_core__out_of_line_bug_R8b0fd3c5ppp_input_R90a6ceda__pppoe_xmitsk_run_filter_Rda4ad3aa___pskb_trim_R0870c3f3sock_rfree_R7e86c086__kfree_skb_R2dd8a99cpppoes_ptypepppoed_ptypepppoe_sock_destructkfree_R037a0cba__this_modulesk_alloc_R8dd64ed6sock_init_data_R79e61d16pppoe_opskmalloc_R93d4cfe6pppoe_releasepppoe_connectdev_get_by_name_R254dd5f1pppoe_chan_opsppp_register_channel_R7d1dac95pppoe_getnamepppoe_ioctl__get_user_4pppoe_sendmsgsock_wmalloc_R07d4d566skb_over_panic_Ra9587909memcpy_fromiovec_R9fb3dd30dev_queue_xmit_Ra3816605alloc_skb_R1de2b30dskb_clone_Rce79cdaeskb_under_panic_Rf4c660d4pppoe_xmitpppoe_rcvmsgskb_recv_datagram_R771432afmemcpy_toiovec_R9ceb163cpppoe_proc_infosprintf_R1d26aa98sock_no_bind_Ra520bc77sock_no_socketpair_R0990a4efsock_no_accept_R15233bacdatagram_poll_R50418fdcsock_no_listen_R2690cf68sock_no_shutdown_R74f4c7d7sock_no_setsockopt_Rbc4363fbsock_no_getsockopt_Rb76c279esock_no_mmap_R83848d52pppoe_protopppoe_initregister_pppox_proto_R565ba654dev_add_pack_Rf59dd192register_netdevice_notifier_R63ecad53proc_net_R7a4689f1create_proc_entry_Rd8ee2b5bpppoe_exitunregister_pppox_proto_Re0ff7a18dev_remove_pack_Ree174f75unregister_netdevice_notifier_Rfe769456remove_proc_entry_R3a97d148init_modulecleanup_module__module_author__module_descriptionz09`f '3Ki !"#$1&'7&M()*+6$Q,y,%($Sqw $,01111273D4[%/5$ 1W!g,$& 2 H N      !9 8    9 :  "/ #4 : h ! = =   $?`&~@A, B""O#TZ C\&z@DE,BK,y(HI#,DNK[dK"U)W7-<XA.FXKPYUZ`e[sJ]-^.^_Z` ,<L\l|`tF6L7MN;O<PQRS>GT<) ELFX4( ÍvWS\$ hj\lj{htN1CDǃxǃSCX fCX1ǃ [_ËD$@hL$@Q\P Apt Ipt Q1ÉD$@h4@hh|h|1ÐWhhP1R4_É'01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLdummy%dGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.data.bss.note.modinfo.rodata.comment@0  %p+` 069?G0P8   0I\tgwx2?H3- )C_o?{3dummy.cgcc2_compiled.__module_kernel_version__module_using_checksumsset_multicast_listdummy_initdummy_get_statsdummy_xmitdummy_init_moduledev_dummydummy_cleanup_module__module_licensekmalloc_R93d4cfe6ether_setup_R7940ef23__kfree_skb_R2dd8a99c__this_moduledev_alloc_name_R2ebab30fregister_netdev_Rc1644cbeunregister_netdev_Re6fb46dfkfree_R037a0cbainit_modulecleanup_module.8BH ! . .. netfilter7ip_gre.o . ..ip_conntrack.oip_conntrack_ftp.oip_conntrack_irc.o ip_nat_ftp.o ip_nat_irc.o ip_tables.oiptable_filter.oiptable_mangle.o iptable_nat.o ipt_limit.o ipt_mark.o ipt_mac.o ipt_multiport.o! ipt_owner.o" ipt_tos.o#ipt_ah.o$ ipt_esp.o% ipt_length.o& ipt_ttl.o' ipt_state.o( ipt_unclean.o) ipt_tcpmss.o* ipt_REJECT.o+ ipt_MIRROR.o, ipt_TOS.o- ipt_MARK.o.ipt_MASQUERADE.o/ipt_REDIRECT.o0ip_nat_snmp_basic.o1 ipt_LOG.o2 ipt_ULOG.o3 ipt_TCPMSS.o4 arp_tables.o5arptable_filter.o6 ip_queue.oELF44(D$T$ff9BÐUWVS\$t$|$C PC PC PCPCPCPCPPhVŃ(SVGʼn[^_]WVS\$t$CPh!VCPPS7Poh6Vlj$[^_ÐUWVSt$l$FPǃ~DtVL)¹Qv1RFPG Ph8UV+PGWFP+PËF@(uhE+PÃWF,P+PËF@ thR+PÃPh]+Ph6+PÉ؃[^_]ÃUWVS11D$;=sgvD$Ƌ9t9KA$9tE;D$ |QD$P;D$$w …uVD$D$;rt8E;D$ |%SD$Pǃ;|$$v &uȸ u xD$+l$ ([^_]YÐD$txu RøUWVSt$\$L$T$ l$$x(URQVSt1&G$9B\vUR t&[^_]ÉT$x\v@ $wt heËD$PD$PD$PRD$PS1ۃ|$ÅPjh @ @$hÃ}hhÃ} hbh4Ã} h 6hLÃ}Xh` hLh4hhPh[ÐVSL$ 1=tQ8Pu-=uHA   u x[^SL$QPXu zuu uxujAPh  [ÍvjÐjPQRZYXPQRZYXTPQRZYX{PQRZYX뉍t&D$&u1:BuEÊD$P u zvÍvST$ L$\$BABfARQCЃ[ÐL$Q APQ(A$Pt Q\AXPÐS\$t xt tP@ЃC:Pt @(tSЃtSЃSP [ÐS\$SK u xpt„tP@Ѓ[Ã(UWVSD$E3B#Au3Ef3Bf#Au%E f3B f#A uEf3Bf#AfDttHC,xt?D$@@C,T$SPC,|$xt |$ u x*tC(t T$RЃD$[^_](Ív UWVSl$8E@U)B @?tREu !E@ @ PD$UB \$x uD$4PSR }D$D$W t$ O\BtB Ph1S$9wB D$ BD$(fB fD$.V$)Q$PT$ BЃ 2jVƒu%WD$PVKƒ v`JA$9uD$.A@tA@tD$BZv 1vD$PUB\PB PST$$B Љƒt.tht^D$PSUB\PB PA(Љƒu>Et„t P@ЃEǀ&|$t C@[^_] ÉVS\$t$ CPPSV\[^ÉD$H\PXJǀÉ0UWVS\$Ht$LD$Dt PT$DB`CBdCBhC BlBpFBtFBxF B|D$PXT$Ջ?w#ut$ Gf#EfD$$W #U T$(w$f#u$ft$,G&T$ f#E&fD$.D$$t$(D$4D$,\$DT$0t$t$8D$fET$T$|$t u x ?T$Pt$DFXB u x 1[^_]0ÉD$P ux ÍvUWVSl$t$UVKt, ux^ t&11E,FE0FE4F E8t&t͋SK13C#Cu>F3B#Au3Ff3Bf#Au%F f3B f#A uFf3Bf#AfDt uxt&[^_]ÉT$ PB u xx1UWVSD$1۽PP;so5 0{Ë 9tAAT$9u.ǀQtB\RXBAǀ붉;rH u z u x  [^_]ÐWVSt$|$~u~L#^DStFLS uxo[^_VS\$ s t)F(t SЃǃC Sà u xutN(t V{`tFj St7Cpt Kpt StN(t V1Ct)F(Cxs ǃFdN(t VC P؀[^ÍvVSt$ D$p)Fэ[^UWVSl$11;sNƍy9u1UCPT$҃t܉ډu ;=rtB u x[^_]ÐWVS|$t$KvCDPt CPKpt„tP@ЃVWÃu[^_à WVST$0\$8BD$ B"fD$D$BfD$D$ D$D$D$ D$fD$D$$D$D$(Duu1 tt&D$<8w jD$ PƒfD$ B@fD$B@D$Jpt„tP@Ѓ!9P t$ u vt t&1[^_ øÉP u xvjhtᐡPPh áSt8 v  =w PRh@hÃ\hchP uh!vjjh jh\hcuhBBB u x*19s@B9rjhu*PPh [ST$L$ \$BtB Ph1I$9w3B BCfB fCS$)QPD$ @Ѓ 1[PQRZYXDPQRZYX6PQRZYXPQRZYXPQRZYXPQRZYX*PQRZYXPQRZYXPQRZYXPQRZYX;PQRZYXaPQRZYXPQRZYX2PQRZYXxPQRZYXPQRZYX(PQRZYXPQRZYXPQRZYX?PQRZYX$PQRZYX&D$ f@f@ ÉD$f@f@ É1Ð1ÐD$h`PøÉT$L$ fABfA ÍvT$L$B fABfA ÉT$L$B PBPhQÐD$ u xDPh4D$ P ÉD$@ tèt1ètèu Ít&ÉUWVST$t$l$ $S 9D$s S~B‹ u ux먉uvC $<uC@ȉ u xF@u!C tFDPtCVFTЃ8u"wC $<u9Cu F@lPV[^_]ÉT$$PŠ tD$1PQRZYX.PQRZYXPQRZYX)t&'T$L$ fABfA ÍvT$L$B fABfA ÉT$L$B PBPh<QÐ1ÐS\$C@thPFSC@h S[ÉÍ&'T$L$ A BfABA ÍvST$ L$z wB <u1BfAB ˈY B A [ÐT$L$BPB PB PhUQÐ1ÐS\$|$v,t3CDPt#SCTЃt&h S[ÐT$zw Bu1ǂÍv'src=%u.%u.%u.%u dst=%u.%u.%u.%u EXPECTING: proto=%u %-8s %u %lu [UNREPLIED] [ASSURED] use=%u ipt_hook: happy cracking. ip_conntrackip_conntrack: can't register pre-routing hook. ip_conntrack: can't register local out hook. ip_conntrack: can't register post-routing hook. ip_conntrack: can't register local in hook. ip_conntrack_core: Frag of proto %u. <4>ip_conntrack: table full, dropping packet. TCPip_conntrack_maxipv4netip_conntrack (%u buckets, %d max) ip_conntrack<3>Unable to create ip_conntrack slab cache unknownLISTENLAST_ACKCLOSE_WAITCLOSETIME_WAITFIN_WAITSYN_RECVSYN_SENTESTABLISHEDNONEsport=%hu dport=%hu %s tcpsport=%hu dport=%hu udptype=%u code=%u id=%u icmpkernel_version=2.4.19-pre9using_checksums=1license=GPLkernel_version=2.4.19-pre9using_checksums=1parm_hashsize=ikernel_version=2.4.19-pre9using_checksums=1ip_conntrack_protocol_register_R8e288131ip_conntrack_protocol_unregister_R01939918invert_tuplepr_R5e68d8a9ip_conntrack_alter_reply_R85dc02e5ip_conntrack_destroyed_Ref5b77f8ip_conntrack_get_R51a42c8cip_conntrack_module_Rb0361033ip_conntrack_helper_register_R1844eee6ip_conntrack_helper_unregister_R40d1f34fip_ct_selective_cleanup_R74c9972aip_ct_refresh_R561efb44ip_conntrack_expect_related_Raed0cb12ip_conntrack_unexpect_related_R5963f8a1ip_conntrack_tuple_taken_Rbe57882bip_ct_gather_frags_R4c8fea39ip_conntrack_htable_size_R8ef8af4c8,8PQ)$m)mD@ X p t x  ..p..p .      8 !!"Q0#P#p#### l#$X$$$$GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)01.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.rel.text.rel.fixup.rodata.modinfo.kstrtab.rel__ksymtab.rel__ex_table.rel.data.bss.comment.note@% 7P )P%% B0`%q 8(A) N,J B\-X C k -@ g D q`2 v`2 3x3Ep o @SPVu @Imv.6s<sts{ KTY~|px ~  ~ ).~5 :HM~T Y}a f}n s}{ }xx.3<QYjoxx~x'-  )/}7 x   u   ! ' N ] c   F K ~  6 = c  w   # - 5 > GN _t}~fm  _sgs o ~ttssjpsss%+h t xx  & +1JUemsxx1EwQu\dj-Dcv 2BHxwkz%27=SX] i{qwt|   ~ &q.7 <afvkw|~# (-9?tDJO Tdh~ -=M]m}  -   !!!#!6! "b"w" "" " ######($ u${$$w$$ r  $(,048<@yDHLPTX\`|dhlpotx|x $<Tss   HX   $DHLPTX\`dhLPTX\`d  $     *B[- lw\tO(^,X  *4 ?L Yi n s*9BT   D+p/sT%h9, D S ybs8D, X DX X  @ <@ QX fp zt x   *vB@ D( l(     +& !B:"\P!6p!2{"90#0#P#p#+##:###!! -$C?X$+P$e$Sq $*) (:VjxD1,D\ n@( #28c @'`   Tv# = Hi pys 0 &     9 @+n `l  )   &7 1B $`Z l k t (   ) G ] }   f U ?  x@  ^ D 8 #  @0 @/!Z"m" 0EPg0 Hh';`| q |#0 : [X p0ip_conntrack_standalone.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensekill_protoprint_tupleprint_expectprint_conntracklist_conntracks.text.lock.ip_conntrack_standaloneip_confirmip_refragip_conntrack_localip_conntrack_in_opsip_conntrack_local_out_opsip_conntrack_out_opsip_conntrack_local_in_opsinit_or_cleanupinitfiniip_conntrack_core.chelpersip_conntrack_maxip_conntrack_count.text.lock.ip_conntrack_coreinvert_tupleclean_from_listsdestroy_conntrackip_conntrack_cachepdeath_by_timeout__ip_conntrack_findearly_dropdrop_next.1530init_conntrackunexpect_relatedip_conntrack_attachget_next_corpsegetorigdstso_getorigdstip_conntrack_tableip_conntrack_dir_tableip_conntrack_root_tablekill_allip_conntrack_sysctl_headerhashsizeip_conntrack_proto_generic.cgeneric_pkt_to_tuplegeneric_invert_tuplegeneric_print_tuplegeneric_print_conntrackestablishednewip_conntrack_proto_tcp.ctcp_locktcp_conntrack_namestcp_timeoutstcp_conntrackstcp_pkt_to_tupletcp_invert_tupletcp_print_tupletcp_print_conntrack.text.lock.ip_conntrack_proto_tcpget_conntrack_indextcp_packettcp_newip_conntrack_proto_udp.cudp_pkt_to_tupleudp_invert_tupleudp_print_tupleudp_print_conntrackudp_packetudp_newip_conntrack_proto_icmp.cicmp_pkt_to_tupleinvmap.1071icmp_invert_tupleicmp_print_tupleicmp_print_conntrackicmp_packetvalid_new.1084icmp_newip_ct_gather_frags_R4c8fea39ip_conntrack_init__vmalloc_R79995c5b__kstrtab_ip_conntrack_protocol_register_R8e288131expect_listkmem_cache_destroy_Rdf83c692jiffies_R0da02d67kmem_cache_create_Rd1c0b4e6del_timer_Rfc62f16d__this_moduleip_conntrack_helper_unregister_R40d1f34funregister_sysctl_table_R7e7e1a0fschedule_R4292364cip_conntrack_unexpect_related_R5963f8a1nf_unregister_hook_R9269e08aprintk_R1b7d4074ip_send_check_Ra37b7441skb_linearize_Rdc5fb764ip_conntrack_lock__kstrtab_ip_conntrack_unexpect_related_R5963f8a1__ksymtab_ip_conntrack_protocol_register_R8e288131cleanup_module__kstrtab_ip_conntrack_tuple_taken_Rbe57882bip_conntrack_alter_reply_R85dc02e5__ksymtab_ip_conntrack_helper_register_R1844eee6__ksymtab_ip_conntrack_destroyed_Ref5b77f8__kstrtab_ip_conntrack_helper_register_R1844eee6ip_fragment_R0c6d67fd__ksymtab_ip_conntrack_unexpect_related_R5963f8a1init_moduleip_conntrack_inkmem_cache_free_R891f2686__ksymtab_ip_ct_selective_cleanup_R74c9972aget_tupleip_conntrack_generic_protocol__kstrtab_ip_conntrack_expect_related_Raed0cb12vfree_R2fd1d81c__ksymtab_invert_tuplepr_R5e68d8a9sk_free_R2e231f58proc_net_R7a4689f1nf_unregister_sockopt_Re9a21e2d__kstrtab_ip_conntrack_protocol_unregister_R01939918ip_ct_selective_cleanup_R74c9972akmem_cache_alloc_R75810956__kstrtab_ip_conntrack_helper_unregister_R40d1f34fip_ct_attach_Rec584387__kstrtab_ip_ct_gather_frags_R4c8fea39ip_conntrack_get_R51a42c8cfind_protoip_ct_refresh_R561efb44sprintf_R1d26aa98__kstrtab_invert_tuplepr_R5e68d8a9ip_conntrack_protocol_register_R8e288131__ksymtab_ip_conntrack_get_R51a42c8cremove_proc_entry_R3a97d148proc_dointvec_R2de43772num_physpages_R0948cde9nf_register_sockopt_R27df8879__kfree_skb_R2dd8a99cregister_sysctl_table_R9668c988csum_partial_R9a3de8f8__kstrtab_ip_conntrack_module_Rb0361033__module_parm_hashsize__ip_conntrack_confirmip_conntrack_find_getirq_stat_R903e93e1__ksymtab_ip_conntrack_htable_size_R8ef8af4cip_conntrack_module_Rb0361033ip_conntrack_tuple_taken_Rbe57882b__kstrtab_ip_conntrack_alter_reply_R85dc02e5create_proc_entry_Rd8ee2b5bip_conntrack_protocol_tcp__ksymtab_ip_conntrack_helper_unregister_R40d1f34fnet_ratelimit_Rf6ebc03b__kstrtab_ip_conntrack_destroyed_Ref5b77f8__kstrtab_ip_ct_selective_cleanup_R74c9972aip_conntrack_protocol_unregister_R01939918invert_tuplepr_R5e68d8a9ip_conntrack_expect_related_Raed0cb12__ksymtab_ip_conntrack_module_Rb0361033__ksymtab_ip_conntrack_alter_reply_R85dc02e5__ksymtab_ip_ct_refresh_R561efb44ip_conntrack_protocol_udpip_conntrack_helper_register_R1844eee6nf_register_hook_Re64eb24b__kstrtab_ip_ct_refresh_R561efb44__ksymtab_ip_conntrack_tuple_taken_Rbe57882bsock_wfree_R5226dcc8ip_defrag_Ra79305b3__kstrtab_ip_conntrack_get_R51a42c8cicmp_error_trackip_conntrack_htable_size_R8ef8af4cadd_timer_Ra19eacf8ip_conntrack_cleanup__kstrtab_ip_conntrack_htable_size_R8ef8af4c__ksymtab_ip_conntrack_protocol_unregister_R01939918ip_conntrack_protocol_icmpip_conntrack_destroyed_Ref5b77f8__ksymtab_ip_conntrack_expect_related_Raed0cb12do_softirq_Rf0a529b7protocol_list__ksymtab_ip_ct_gather_frags_R4c8fea39__find_protoip_conntrack_hashELF` 4( UWVS\$l$(|$$D$,D$T$0T$41tft11;L$ sW9sS}|$B< w T$$|$$DBЉ:T$t:T$u;L$uAFC;t$ s9r1[^_]YZS\$L$ T$D$Pj,jRQS5[ÃWVS\$|$t$$L$D$ D$19sQ8uJt&%‰FA0< w%ҍfЍPA9sD$8ufu1[^_YUWVSt$|$l$v%u ~~ ~1uF8t 1<Sj.jUGPFPZƒtEPSWBPV1[^_]ÐSL$\$ v&u ~~A8uQ8t1D$PPSjQ[ÉUWVS|$\$D$ t$$l$u:CPMQEPEPD> PD> PCPPEPURPE(uE}v}u8t(MQUBPMIPh1F}7E)EEU ЋU ЋUM E;uAEUMBEAEAURA Ef EfA =M1}D‹UEE ЋU EȉEEf EfEċEfEE؋EE܋EfEEEĉEEfEEfEfEjEPEPEP u x|[^_]ÉVS1ۃ=t#@V,C <u[^ÐUWVS=u D$=tr@ 1EfF fFfFfF&F(VÃtU$t& ,D$|$}u1[^_]YPQRZYXPQRZYXt&'` [()V LQ()01.01kernel_version=2.4.19-pre9using_checksums=1parm_ports=1-8iparm_loose=ilicense=GPL<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value 229 EPRT227 PORTconntrack_ftp: partial %s %u+%u ip_ftp_lock_R0a75f158ip_conntrack_ftp_Red617569GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.kstrtab.rel__ksymtab.comment@ )l% 0H/@ 4@:TVC K 1X T x  b 0 k 0 #;TZ `a$lLuR| U|3 @`   J  1?-S= gxBi    |3ip_conntrack_ftp.cgcc2_compiled.__module_kernel_version__module_using_checksumsloosesearchtry_rfc959try_eprttry_espv_responsetry_numberget_portfind_patternhelp.text.lock.ip_conntrack_ftp_Red617569finiportsftpinitports_c__module_licenseip_ftp_lock_R0a75f158ip_conntrack_ftp_Red617569__this_module__module_parm_ports__module_parm_loose_ctype_R8d3894f2strnicmp_R4e830a3ecsum_partial_R9a3de8f8irq_stat_R903e93e1do_softirq_Rf0a529b7net_ratelimit_Rf6ebc03bprintk_R1b7d4074ip_conntrack_expect_related_Raed0cb12ip_conntrack_helper_unregister_R40d1f34fip_conntrack_helper_register_R1844eee6__kstrtab_ip_ftp_lock_R0a75f158__ksymtab_ip_ftp_lock_R0a75f158__kstrtab_ip_conntrack_ftp_Red617569__ksymtab_ip_conntrack_ftp_Red617569init_modulecleanup_moduleh##W$h$n%&&&S( )3&J*R&X&+,2Y'i'  ( 8@ PX h- /ELF4( UE@E tM U9wbBU< uEUj URP‹EE 8 u @E8 tj EPEP‹EfUE1 ]ÍvPUWVS|$dL$p$:D$,ÊC ݋\$h)Ӊ)ƃD$ D$ll$(D$D$@D$DD$HfD$LfD$N_|$ Tt G>T$,B 9&jSD$4P‰؆WW ƒ% =t$$qt E&D$T$PT$D$t&\$< O,D$Pt$u1[^_]VS1ۃ=t! V,C <u[^PQRZYXt&'ke_XQ01.01kernel_version=2.4.19-pre9using_checksums=1author=Harald Welte description=IRC (DCC) connection tracking modulelicense=GPLparm_ports=1-8iparm_desc_ports=port numbers of IRC servers<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value SCHAT TSEND MOVE CHAT SEND DCC <4>Forged DCC command from %u.%u.%u.%u: %u.%u.%u.%u:%u ip_conntrack_irc: ERROR registering port %d GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@p  )` % 0 /  4 :@  C` K`0T   l O#;T^ otU  `$1 @+1, (HL%3=Vm 4@$1ip_conntrack_irc.cgcc2_compiled.__module_kernel_version__module_using_checksumsports_n_c__module_licensehelp.text.lock.ip_conntrack_ircinitportsirc_helpersfini__module_author__module_description__module_parm_ports__module_parm_desc_portsdccprotosip_irc_lockip_conntrack_irc__this_moduleparse_dccsimple_strtoul_R20000329csum_partial_R9a3de8f8irq_stat_R903e93e1ip_conntrack_expect_related_Raed0cb12do_softirq_Rf0a529b7net_ratelimit_Rf6ebc03bprintk_R1b7d4074ip_conntrack_helper_register_R1844eee6ip_conntrack_helper_unregister_R40d1f34finit_modulecleanup_module8dV X "D I#$ #*28%KY!  ( 0 8 @ LELF$ 4( VS\$$T$0t% uxC&1F tu JR t&J,R4 u xvtuD$D$ D$D$1҃t EЃuD$ FfD$fD$SD$ PD$0P‹D$D [^ÐUWVSl$<\$@t$HD$8RfPT$<BPBPBPD$HPhQD$0D$,P |$1IQD$PSUV|$XWD$HP[^_]Ív UWVSl$@\$Dt$LD$reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %u,%u,%u,%u,%u,%u|1|%u.%u.%u.%u|%u||||%u|FTP_NAT: partial packet %u/%u in %u/%u ftp%2.2dip_nat_ftp: error registering helper for port %d GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@  ) % ( /@ 4@:TIC K0T,    5NVg|}{bh| >  T(0=  -!4Iew"EhT(>ip_nat_ftp.cgcc2_compiled.__module_kernel_version__module_using_checksumsports_cftp_nat_expected.text.lock.ip_nat_ftpmangle_rfc959_packetmangle_eprt_packetmangle_epsv_packetmangleftp_data_fixuphelpftp_expectfiniportsftpinitftp_names__module_license__module_parm_portsirq_stat_R903e93e1do_softirq_Rf0a529b7ip_nat_setup_info_Rd5c7de6csprintf_R1d26aa98ip_nat_mangle_tcp_packet_R133a3ef5ip_conntrack_expect_related_Raed0cb12ip_nat_delete_sack_Raae8a4b0net_ratelimit_Rf6ebc03bprintk_R1b7d4074ip_nat_seq_adjust_R0cb92b54ip_nat_helper_unregister_R0f85d948ip_nat_expect_unregister_R6b82ec38ip_nat_expect_register_Rcf60ab1eip_nat_helper_register_R5777fafdinit_modulecleanup_module#)gm= K v!  ! , W!"X#A$d i%qw&"(';CH(\a)t}  *;JP U%fk( ELF4( VS\$$t$(D$0t  u x1kt&HV u xvtuD$D$ D$D$SD$ PV‹D$D [^Ã(UWVST$HP l$m[^_]YPQRZYXPQRZYXPQRZYXPQRZYXTPQRZYXb&01.01kernel_version=2.4.19-pre9using_checksums=1author=Harald Welte description=IRC (DCC) network address translation modulelicense=GPLparm_ports=1-8iparm_desc_ports=port numbers of IRC servers<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %u %uIRC_NAT: partial packet %u/%u in %u/%u irc%2.2dip_nat_irc: error registering helper for port %d GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@  )%  / 4:  C  K00T   L 5NV gx9x 6 L 0 @+9,/BWs0SvL6ip_nat_irc.cgcc2_compiled.__module_kernel_version__module_using_checksumsports_c__module_licenseirc_nat_expected.text.lock.ip_nat_ircirc_data_fixuphelpirc_expectfiniip_nat_irc_helpersinitportsip_nih_names__module_author__module_description__module_parm_ports__module_parm_desc_portsirq_stat_R903e93e1do_softirq_Rf0a529b7ip_nat_setup_info_Rd5c7de6cip_conntrack_expect_related_Raed0cb12sprintf_R1d26aa98ip_nat_mangle_tcp_packet_R133a3ef5ip_nat_delete_sack_Raae8a4b0net_ratelimit_Rf6ebc03bprintk_R1b7d4074ip_nat_seq_adjust_R0cb92b54ip_nat_helper_unregister_R0f85d948ip_nat_expect_unregister_R6b82ec38ip_nat_expect_register_Rcf60ab1eip_nat_helper_register_R5777fafdinit_modulecleanup_module!'GM ' 1 i!"@#c h$qw%!'&4;@'TY(js  ) $=M]m} ELF0(4(tD$Ph1É,UWVSD$@D$8D$(L$PZ \$4$É\$0R\\$4)fT$.D$$ƃ|$HEt$Ht$$|$LED$LD$ SրA4L$Dp@t$\ t$L L$T$T$@KT t$4F #C;CSt g]D$4P#S ;SЊCSD$t 7-11ɋt$$3D#D0 BvT$t 11ɋt$ 3D #D@ BvT$t SPft3L$4fA f9T$@tu1CRt |$DЊL$ t OE1ɿpf{Xpval$8D$@4NUD$2PD$8PD$ PF PD$`PD$`PRA(Љƒ 1ɸDȅCX9rT$4BShSlC`SdCX؋Pz(uK@ }!\$L$L$s\t$T$CZ9tL$+L$H\D$^t$TV PD$TPL$TQt$TVD$TPB(ЋL$XD$@r t$L$Ɖt$HR\)fT$F|$(uCZÃ|$8Y u x|$8uD$(ЉD$(ԍ1[^_],ÉUWVS] M V1utI1'U;Utzެuu1 uuEMЅ}1Iu%?)ĉ笪uމ1OuTM 1ut1G1'U;Utzެuu1 uuEMxЍe[^_]ÐUWVSD$t&D$$T$L$$t$( L@L$.Y`AdT$BXЉD$R\ tRSL$$Qh@1L$t$  ‰V\D$D$ef~XpuxƉאַuu1 u`D$x }V1T$<uJ@vL$ދY`q\ D$@`@d9tnT$$T@T$BZ9tD$L$T$SD$0hPh1RhƒuT$0sB4t @B4HSVSz,t@L$QPC PWD$PPB,ЃuC@4t HC@4HE1҅uGX9BT$,GX8SD$,hPh1Rh.ƒB4t @B4HSC=u+f;$uaK | D$L9wO1҃N…uMPT$4t@Sz0tPC PB0ЃC@4t HC@4HGX9rl$,uGZD$ D$HL$ ;tL$HD$T$;D$T$H|@D$8HL$8p;>Sz0tPC PB0ЃC@4t HC@4HGX9r8Sz0tPC PB0ЃC@4t HC@4HT$HGZD$D$;I t&D$8[^_],ÉSL$D$ \$Q4;Bt% u xoD$1"Y4BC u xQ[ÃUWVS|$t$ 1&D$1@D$;s=\$T@D$jhljll D$j`,jdlBZ;rNjD$t[^_]YZÐUWVST$0D$B4@hchSD$, u |$ D$tftT$ R\$4C4P u xTD$,PT$4B4@P\$4+~1IAPFPT$DP 3EX9r(z1IAPBP\$EXDP EZD$$D$,D$9D$$ T$ RD$ [^_]ÍvS\$ D$hPh(Sh$ƒt>J49C uD$$PRPD$ D$D$[YÃpUWVS$!\9P ȍt$$t$u|$ |$1t T$LB\9$t ;wB@cVhPD$( u bD$LPC\PD$$@Pà tD$ $t&D$xVhPD$$ uD$ t&T$x|$tftD$dPD$TPD$PPD$XPT$,RD$XPL$(QD$<t$ hVh(D$Ph$ÃC,9D$DtD$ &VT$ R$PSŃ_S8t:ME9wt$9Fv BC8Ht9vL$9Aw JC8Ht$VUD$D$;ET$|@pfXpvJ&>Sz0tPC PB0ЃC@4t HC@4HGX9rGX8Sz0tPC PB0ЃC@4t HC@4HGZD$L$;MSUD$xPt$V$P V]1&HD$1;(T$|*@pfXpvC>Sz0tPC PB0ЃC@4t HC@4HGX9rGX8Sz0tPC PB0ЃC@4t HC@4HL$GZ;)]t$VD$PD$$[^_]pÍv4UWVS\$H!D$$T$9P ȍl$ u މL$ 1 |$t]t&D$@$9D$Lt?hchD$TPD$ u&L$LQSD$P t D$D$hPh(Uh$ǃW4L$A 9BtD$fD$1ۉ;sPL$$t$t&T@D$ljhl jlD$,j`ljdBZËG4;rčt& u x  l$UD$ [^_]4ÍvST$ \$L$!u-H@tAtQSQS[Ð|UWVS$$!u H@tAG$:TD$ T$9P ȍl$luމL$ 1|$.Ƅ$D$hPh(Uh$4A,D$8A4P @ D$E({@p\@(tftU(B@PB,PuB$PB(PSE,PVcD$0u  1D$L$t%S D$ $ $t'y֬uu1 u݅t D$ZE4@D$PSjU't>E4PPE0$hEE$-$L$UD$S  ҍ[^_]YZÐUWVS D$PPT$B41;(|(@pfXpvC>Sz0tPC PB0ЃC@4t HC@4HGX9rGX8Sz0tPC PB0ЃC@4t HC@4H\$GZŋC4;(^T$B4P  [^_]ÃVS\$t$D$D$ C  D$9~FD$ 1>v1:D$ t<wB|t DB9r׉[^YÐUWVSt$(D$,l$0T$4fT$uD$81uf|$wT$81D$E^N 1f;r f9GT$9M^V !1f;Nr f9GD$9tOE "F :F tt5t1~t#D$8PЃPD$PUFP~tD$D$[^_]YZËD$1ɋ@P%@u|$ uD$ @ $DʉÍvUWVSt$ T$$l$(D$,ufwD$01`1uXE^N1f;r f9G9t1M͊FF1f;Nr f9G׸9E[^_]ÍvD$@P%@t1Ã|$ uD$ @u Ív1ÐWVSt$ T$$\$(D$,ufwD$01D1u<NFD$FD$[1:u:\$r :\$G׸9E[^_YÐD$1ɋPP@u|$uD$ @$DʉÍvUWVSl$ 11 1L$t 1`$$t1F9rCPhfD$ P ;D$$w ˍL$D$)0[^_]Yù rBB B@@D@ B Bh|NPjhj t@ <uh@$h1hPhjPQRZYXl6~[PQRZYXPQRZYXPQRZYXjPQRZYX7LX$0m!' $$ERROR@B@BHtcpudp`icmp 01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLip_tables: error: `%s' iptable_ipt_iptables: loop hook %u pos %u %08X. %s ip_tables_namesip_tables: (C) 2000-2002 Netfilter core team  QP1XY=QP1XYeQP1XYQP1XY ?g(8ipt_register_table_R95efde7bipt_unregister_table_Ra505d718ipt_register_match_R4c7b317eipt_unregister_match_R27635291ipt_do_table_Rf21ec974ipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3eGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.kstrtab.rel__ksymtab.comment@p" `8)" % @?/$4$:$9C % O%HK ?( Z(&(V ?P e`& r@'8n @@p|x'0'P+4 @1  4MWbl$w !T^8 d w    p+)6,FSUHd@@s1`3w -8,@888<.3 ! 8- Iar '7OrX9X9X%DVt -  V? `  @ a (  0 !ip_tables.cgcc2_compiled.__module_kernel_version__module_using_checksumsipt_mutexipt_targetipt_matchipt_tablesipt_errornulldevname.1422.text.lock.ip_tablesfind_inlist_lockmark_source_chainstranslate_tableipt_standard_targetreplace_tableget_counterscopy_entries_to_userget_entriesdo_replacedo_add_countersdo_ipt_set_ctldo_ipt_get_ctlbootstrap.1510tcp_find_optiontcp_matchtcp_checkentryudp_matchudp_checkentryicmp_matchicmp_checkentryipt_error_targetipt_sockoptstcp_matchstructudp_matchstructicmp_matchstructipt_get_tablesinitfini__module_licensenet_ratelimit_Rf6ebc03bprintk_R1b7d4074ipt_do_table_Rf21ec974irq_stat_R903e93e1do_softirq_Rf0a529b7__down_failed_interruptible__up_wakeuprequest_module_R27e4dc04__vmalloc_R79995c5b__generic_copy_to_user_Rd523fdd3vfree_R2fd1d81cnum_physpages_R0948cde9__generic_copy_from_user_R116166aaipt_register_target_R70b9d421__this_moduleipt_unregister_target_R62fb2d3e__down_failedipt_register_match_R4c7b317eipt_unregister_match_R27635291ipt_register_table_R95efde7bipt_unregister_table_Ra505d718sprintf_R1d26aa98nf_register_sockopt_R27df8879proc_net_R7a4689f1create_proc_entry_Rd8ee2b5bnf_unregister_sockopt_Re9a21e2dremove_proc_entry_R3a97d148__kstrtab_ipt_register_table_R95efde7b__ksymtab_ipt_register_table_R95efde7b__kstrtab_ipt_unregister_table_Ra505d718__ksymtab_ipt_unregister_table_Ra505d718__kstrtab_ipt_register_match_R4c7b317e__ksymtab_ipt_register_match_R4c7b317e__kstrtab_ipt_unregister_match_R27635291__ksymtab_ipt_unregister_match_R27635291__kstrtab_ipt_do_table_Rf21ec974__ksymtab_ipt_do_table_Rf21ec974__kstrtab_ipt_register_target_R70b9d421__ksymtab_ipt_register_target_R70b9d421__kstrtab_ipt_unregister_target_R62fb2d3e__ksymtab_ipt_unregister_target_R62fb2d3einit_modulecleanup_module4 5h 7o7u7\;/ 45e  i o  u     7 7 7 7 7 < 7 7 77 ==J=z> ?<@<} >=>"(AG >><@  -777> =eBkBqwBBBB!'=IBOBeBkBqwBBBB!'=IBOBeBkB<BB>&B0BAK{>BB>BBLRqy I      ) / 4 : ? H N S Y ^ g m r x ~   J K  L   M B  5  M K  !N !8!9$!:.!98!:B!:L!:Y!8i!8y!8!:!:!:!8!:!:!9!:!D!:!9!:"D":"9"":,"D6":@"9J":T"D^":  $( hl$4D  $GOH QESFU 6$W(A,Y0C4[ELFd4( SL$\$ T$D$jhPRQS[ÉT$x\v@ $wt hjhD$PD$PD$PRÉdSvh yУhÃ|bhÃ|@h4Ã| hLÃ})h4hh؃[ÉVS1&SFvh[^Í&'filterl((p$p$p$p@ERRORERRORfilter(01.01kernel_version=2.4.19-pre9using_checksums=1parm_forward=ilicense=GPLipt_hook: happy cracking. iptables forward must be 0 or 1 GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@`  ) % ( / 4 :4HC` K0Tl  l !9R`<n&w(ZHd 2<  -6Qn 2iptable_filter.cgcc2_compiled.__module_kernel_version__module_using_checksumsinitial_tablepacket_filteript_hookipt_local_out_hookipt_opsforwardinitfini__module_license__this_moduleipt_do_table_Rf21ec974net_ratelimit_Rf6ebc03bprintk_R1b7d4074__module_parm_forwardipt_register_table_R95efde7bnf_register_hook_Re64eb24bnf_unregister_hook_R9269e08aipt_unregister_table_Ra505d718init_modulecleanup_moduleGP Uez %2CH$<TELF4( SL$\$ T$D$jhPRQS[ÉUWVSt$ y\vQ $w#t hvL$z jRT$jhD$0PD$0PD$,PVÃtDt?t:B 9x u9huL$9u T$8PtV1D[^_]YZÍvShÃh<ÃhTÃ|`hlÃ|@hÃ| hÃ}ChhlhTh<h؃[VS1<SFvh[^É'mangle(P(Pp$p$p$p$p$p@ERRORERRORmanglej(jj(jj01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLipt_hook: happy cracking. GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@  )@ % 8 /4:9CMKh0T    !9R`<o&~(<x+-  8Sp+iptable_mangle.cgcc2_compiled.__module_kernel_version__module_using_checksumsinitial_tablepacket_mangleript_route_hookipt_local_hookipt_opsinitfini__module_license__this_moduleipt_do_table_Rf21ec974net_ratelimit_Rf6ebc03bprintk_R1b7d4074ip_route_me_harder_Rbc9709c1ipt_register_table_R95efde7bnf_register_hook_Re64eb24bnf_unregister_hook_R9269e08aipt_unregister_table_Ra505d718init_modulecleanup_moduleNW \,1?DRWejx}(8D\tELF 54( UWVSl$ D$|$t|$DD$D$E@Exku@kD$PEPÃu%E@ ҍx u]:uX1T$t?w tMA x uPD$ PSQ|$u&L$uOVSD$0PD$0PD$,PUt uWz{Kt VSVS ux[UL$ QVD$ PS[^_]YZS\$ z\vJ $w ?fA?tRu D$PD$PD$PSD$P[ÐUWVSt$x\vP $wZ&z jD$$PD$$PD$$PVD$$PÃt(t#@ 9x u9htV1D[^_]VSL$ 1=t"Q 9P u 1t&=uHA   u x[^ÉD$PPH u zv ux&  ÉS1ۃ|$Å}ht&Å}hvhÃ}h@hÃ}hh0Ã} hXhHÃ} h,tW@HNtHHhHh0hh[ÉjÐjPQRZYXuPQRZYXPQRZYXPQRZYX>PQRZYXJVST$\$t$ D$PPSVP[^YÍvVST$\$t$ D$PPSVP[^YÍvWVt$ T$v9D$ 9u*@uu1 uD$u1^_ÍvWVt$ T$v9D$ 9u*@uu1 uD$u1^_ÍvUWVSD$<|$0t@t+D$PUVT$LRD$LPWT$DRCЃtӅjh@D$@PD$@PWD$@PD$(usT$@1ɃDEȋuYtu T$B3A#Cu3Bf3Af#Cu%B f3A f#C uBf3Af#CfDtt D$%hEE-  uxt&D$[^_]YÉT$D$9< u zvÍvSL$QPXuzug u xu_t&Qh   [PQRZYXPQRZYX/PQRZYX`PQRZYXPQRZYX딉'SL$t<SX$PSd0P u xv[ÉT$ L$D$$JPjR% YZÍvD$u19B uEÃVSD$t$ P\$ SVS[^Ã,UWVST$@\$Dl$HBPD$SL$DD$ T$$AQ D$(D$ D$0D$$D$4D$(T$,D$8D$,D$E3B#Au3Ef3Bf#Au%Ef3B f#A uEf3Bf#AfDt^l1Ƀ}t }Eȸ e[^_]ÉUWVS\$ CCS1t$C,C4S:1ՍNTQFTP^`SF`PJVTAZV`C[^_]ÉWVSL$AAQ1t$A,A4Q:1ӉNhN\ FTBVTH ؋F`BV`H[^_UWVS|$t$l$ T$(\$$D$JPSUVW@Ѓu G PEPG PfG EG G PEPGPfG EG [^_]ÍvUWVSl$$|$ D$D$D$;E} 1D$,1ۀyitE؅tby u\j QÃu$ u x1D$,Bpt Jpt RD$,D5;D$u7D5 ;D$(u,D$,PD5 PWB\PB PB @ PzD$D$ ;E Ul ux(tD$,PD$,PD$(PUD$,PB(Ѓ[^_]YZÐUWVSD$,\$,@ D$$$D$ Ń)ȋK\)ȋL$ T$09uu{t1.D$D$D$;CT$,”T$s t$1&D;;D$8urL$4D; ;<u3D$P|; PVT$8+D$0J\)PUE P,&;D$4u'D$PD; PT$RL$8A\PD$4PjD$T$D$ ;Sg u xL$ fAj\$SQ% T$ fB[^_]ÍvShchPƒ u ‰BBB ux19s%á@RA9rv1[ÉW|$1#_ÉjhPQRZYX[PQRZYX1PQRZYXPQRZYX>PQRZYX8&'É1ÐÍv1Ð1ÐSD$|$ u@@ †֋D$1f9rD$9Nډ[ÐUWVSl$T$D$uMM uX =$= ?X2t&"t&VB B)X19s7 1:fD$ PUtFf9r1[^_]ÉUWVST$l$$4|$ uZ Z~);D$w/FPEPPPEPSfFEf[^_]ÉUWVSl$t$|$1f~tGPhUà f~ tG Ph+Pà [^_]ÉSD$ \$x tFH Pf9uPhS #ֆPPh%St&1[ÍSD$|$ u@@ †֋D$1f9rD$9Nډ[ÐUWVSl$T$D$uMM uX=$= ?X2t&"t&VB B)X19s7 1:fD$ PUtFf9r1[^_]ÉUWVST$l$$4|$ uZ Z~f~t/FPEPPPEPSfFEf[^_]UWVSl$t$|$1f~tGPh6Uà f~ tG Ph@+Pà [^_]ÉSD$ \$x tAH Pf9uPhJS ֆPPhSS1[É'SD$T$1Hf; rD$f;Fډ[ÐUWVS|$l$1GW )ЋXD9s:`1G fED$ PUuFf`9r1[^_]ÐVST$ t$$؍CPFPCPfCFfC [^ÐUWVSl$t$|$1f~tGPhdUà ~ tfG Phk+Pà ~ tfG Pht+Pà [^_]ÉT$z t'BPB Ph}D$P1Í'ip_nat_init: can't setup rules. ip_nat_init: can't register in hook. ip_nat_init: can't register out hook. ip_nat_init: can't register local out hook. ip_nat_init: can't register local in hook. nat<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value ip_nat_resize_packet: oom ip_nat_mangle_tcp_packet: nat'ed packet exceeds maximum packet size resize_packet failed!! Out of memory cloning TCP packet <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value unknownsrcpt=%u dstpt=%u port %u ports %u-%u TCPsrcpt=%u dstpt=%u port %u ports %u-%u UDPid=%u type=%u code=%u id %u-%u ICMPkernel_version=2.4.19-pre9using_checksums=1license=GPLkernel_version=2.4.19-pre9using_checksums=1kernel_version=2.4.19-pre9using_checksums=1kernel_version=2.4.19-pre9using_checksums=1ip_nat_setup_info_Rd5c7de6cip_nat_protocol_register_R773e0bfbip_nat_protocol_unregister_Rb7d04d48ip_nat_helper_register_R5777fafdip_nat_helper_unregister_R0f85d948ip_nat_expect_register_Rcf60ab1eip_nat_expect_unregister_R6b82ec38ip_nat_cheat_check_R1e4e73a8ip_nat_mangle_tcp_packet_R133a3ef5ip_nat_seq_adjust_R0cb92b54ip_nat_delete_sack_Raae8a4b0ip_nat_used_tuple_R326aecebddnatl((p$p$p$p@ERRORERRORnat`SNAT`DNAT0<08@D2t P H!`"!!@##$$($$\%GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)01.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.rel.text.rodata.modinfo.kstrtab.rel__ksymtab.rel.data.bss.comment.note@% 7@ %% -l)6@*  C`,`? @Q, M A@W2\2e44kB g NN$=FjNTzg_pppppptt 19RtXtozwwww w',w3EUZvbgvotv|vi"|JR|(\q| "(BQWjo~}yyO\w , b h   w k   w "    q uP z  xN ^  1 6 sD s s s s t t  ;JOXgott'-epp   zW d l $0xss& p     3Wwk Jb:@c h   p{{{{p %p.49?DJa m t   6  = T c    !!-!6!p!v!!!" )" " """#)#d#j#######Y$r$$$$%%&%A%J%~%%|  $(,048<@DmHLoPTX\ 8Phxt| (p,p0s4shptx|(048<@     $<U_|g0H`6  - $9<T`(@<2-B0-R`MfMz88$f< 5$<R'< O Xpph8x `n<}00 8 <2@@DTPgPGt~  t r ^H!\!!Gt~ !"l@#^ #W$1$'?`G($oY$?h$s\%7pX #:8a(0 1Ig$n o!8 Ys4i `#(;&`$;@h$  " "6 R i H  DA x~   + X #   f  !$ `%S v ! 0 P  4 #a $u    h\ $  > S (~   ( |6Vk<,x  ip_nat_standalone.cgcc2_compiled.__module_kernel_version__module_using_checksumsip_nat_fn.text.lock.ip_nat_standaloneip_nat_outip_nat_local_fnip_nat_in_opsip_nat_out_opsip_nat_local_out_opsip_nat_local_in_opsinit_or_cleanupinitfini__module_licenseip_nat_rule.cnat_initial_tablenat_tableipt_snat_targetipt_dnat_targetipt_snat_checkentryipt_dnat_checkentry.text.lock.ip_nat_ruleipt_snat_regipt_dnat_regip_nat_helper.c.text.lock.ip_nat_helperkill_helperip_nat_core.cip_nat_cleanup_conntrack.text.lock.ip_nat_corein_rangefind_appropriate_srcip_nat_htable_sizebysourcedo_extra_manglerandomness.1797find_best_ips_protobyipsprotofind_best_ips_proto_fastget_unique_tupleopposite_hookmanip_pktclean_natip_nat_proto_unknown.cunknown_in_rangeunknown_unique_tupleunknown_manip_pktunknown_printunknown_print_rangeip_nat_proto_tcp.ctcp_in_rangeport.1074portptr.1075tcp_unique_tupletcp_manip_pkttcp_printtcp_print_rangeip_nat_proto_udp.cudp_in_rangeudp_unique_tupleudp_manip_pktudp_printudp_print_rangeip_nat_proto_icmp.cicmp_in_rangeid.1074icmp_unique_tupleicmp_manip_pkticmp_printicmp_print_rangeip_ct_gather_frags_R4c8fea39__vmalloc_R79995c5bip_nat_cleanupplace_in_hashesskb_copy_R00b41cc4__ksymtab_ip_nat_used_tuple_R326aeceb__kstrtab_ip_nat_mangle_tcp_packet_R133a3ef5__ksymtab_ip_nat_cheat_check_R1e4e73a8__kstrtab_ip_nat_seq_adjust_R0cb92b54protosskb_over_panic_Ra9587909__ksymtab_ip_nat_protocol_unregister_Rb7d04d48helpers__this_module___pskb_trim_R0870c3f3nf_unregister_hook_R9269e08aprintk_R1b7d4074ip_send_check_Ra37b7441ipt_register_target_R70b9d421ip_route_output_key_Re5733d7fip_nat_protocol_tcpip_nat_setup_info_Rd5c7de6ccleanup_moduleipt_register_table_R95efde7bip_conntrack_alter_reply_R85dc02e5ip_nat_rule_finddo_bindingsipt_do_table_Rf21ec974ip_nat_helper_register_R5777fafdskb_copy_expand_Re8023aa0ip_nat_helper_unregister_R0f85d948init_module__kstrtab_ip_nat_expect_unregister_R6b82ec38__kstrtab_ip_nat_cheat_check_R1e4e73a8find_nat_protoip_nat_expect_register_Rcf60ab1eunknown_nat_protocol__ksymtab_ip_nat_mangle_tcp_packet_R133a3ef5__ksymtab_ip_nat_protocol_register_R773e0bfb__kstrtab_ip_nat_setup_info_Rd5c7de6cip_ct_selective_cleanup_R74c9972aip_nat_lockip_conntrack_get_R51a42c8csprintf_R1d26aa98ip_nat_initip_nat_rule_cleanup__out_of_line_bug_R8b0fd3c5icmp_reply_translation__ksymtab_ip_nat_seq_adjust_R0cb92b54__kfree_skb_R2dd8a99cip_nat_cheat_check_R1e4e73a8ip_nat_protocol_register_R773e0bfbcsum_partial_R9a3de8f8ip_nat_seq_adjust_R0cb92b54irq_stat_R903e93e1__ksymtab_ip_nat_helper_unregister_R0f85d948__kstrtab_ip_nat_helper_unregister_R0f85d948ipt_unregister_table_Ra505d718ip_conntrack_module_Rb0361033ip_nat_protocol_unregister_Rb7d04d48replace_in_hashes__kstrtab_ip_nat_helper_register_R5777fafd__kstrtab_ip_nat_protocol_unregister_Rb7d04d48ip_conntrack_tuple_taken_Rbe57882b__kstrtab_ip_nat_expect_register_Rcf60ab1e__ksymtab_ip_nat_expect_unregister_R6b82ec38__ksymtab_ip_nat_delete_sack_Raae8a4b0net_ratelimit_Rf6ebc03b__kstrtab_ip_nat_delete_sack_Raae8a4b0__kstrtab_ip_nat_protocol_register_R773e0bfbip_nat_protocol_udpinvert_tuplepr_R5e68d8a9__kstrtab_ip_nat_used_tuple_R326aecebnf_register_hook_Re64eb24bip_nat_rule_initip_nat_protocol_icmp__ksymtab_ip_nat_setup_info_Rd5c7de6cip_nat_mangle_tcp_packet_R133a3ef5sock_wfree_R5226dcc8__ksymtab_ip_nat_expect_register_Rcf60ab1eip_conntrack_htable_size_R8ef8af4c__ksymtab_ip_nat_helper_register_R5777fafdip_nat_used_tuple_R326aecebip_route_me_harder_Rbc9709c1nat_expect_listip_conntrack_destroyed_Ref5b77f8ipt_unregister_target_R62fb2d3edo_softirq_Rf0a529b7ip_nat_expect_unregister_R6b82ec38ip_nat_delete_sack_Raae8a4b0ip_nat_seqofs_lockELF4( D$HЇA)‹AQ Q 9vA vQ A9r&)‰Q  u xÍt& u x1ÉT$wi2% Ít&% i2ÉVS\$|$t1wCtPƋP9sCPPh 1>t&CCPhC CPYCPNC[ [^Ðh u1øÉh PQRZYXPQRZYXlimit01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLYCall rusty: overflow in ipt_limit: %u/%u GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@  )` % l  /@4@:T9C` K00T  lx 4MXzhj}|6 8@\-  !>]@i\ipt_limit.cgcc2_compiled.__module_kernel_version__module_using_checksumslimit_lockipt_limit_match.text.lock.ipt_limituser2creditsipt_limit_checkentryipt_limit_reginitfini__module_licensejiffies_R0da02d67irq_stat_R903e93e1do_softirq_Rf0a529b7printk_R1b7d4074__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module@Fag   AF]bn~HLTELF4( SD$T$Z#Bك;Eˉ[Ã|$ u1hÉhÍ&'mark$01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.comment@`  )@ %  /4:9C-0]L`   3L$R$]8h4mDr- 4Dipt_mark.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatchcheckentrymark_matchinitfini__module_license__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module5:EJ(,4ELFd4( UWVSL$\$ 1Q$;Q|r5B;w*r߹u{u{t[^_]ÉD$th1É|$ u Ív1ÐhÉhÍ&'macT01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLipt_mac: only valid for PRE_ROUTING, LOCAL_IN or FORWARD. GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@ 0 )@ %  /@4@:T9C@ K0Tl   2KRQT/d8nsx-  ipt_mac.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatchipt_mac_checkentrymac_matchinitfini__module_licenseprintk_R1b7d4074__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module_ d(,4ELFL4( UWVSL$ T$$\$(D$,ufwD$01Lt&1u@3[9ƍA1I9s!tf94Pttf9PtB9r[^_]ÍvSL$ \$|$ t1+AP1ftfuAR@u;w {FЉ[ÍvhÉhÍ&'multiport01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.comment@  )@@ %  /4:9C0L,`   8Q}WAb8rw|- ipt_multiport.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatchcheckentrymultiport_matchinitfini__module_license__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module(,4ELF4( UWVSl$T$1%tK9P|utBTt8^19}/ߍ&19sF E ;HuB9|1[^_]ÍvUWVSD$@ 5H1xtKD$9u4Tt&1ҋKB9}19sC9ut&u vHu[^_]ÉVSt$ \$F  PCt(9BLCt t&t(F PC9BPCtteu_t*CPVlCt t; t&u0Ct.C PVCt t t&t1[^D$th1Í|$u Ív1ÐhÉhÍ&'owner01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLipt_owner: only valid for LOCAL_OUT or POST_ROUTING. GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@P  P )@ % X  /4:9C@@ K0T   ; 4M}Wvag3r8~$4-   $,4ipt_owner.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatch_pidmatch_sidmatchcheckentryowner_matchinitfini__module_licensepidhash_R36fa7b87init_task_union_R4553e5a1printk_R1b7d4074__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module %*5:(,4ELF4( SD$T$@ Zك@:Eˉ[Ív|$u1hÉhÍ&'tos$01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.comment@`  )@ %  /4:9C-0]L`   2K!Q$\8f4kDp- 4Dipt_tos.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatchcheckentrytos_matchinitfini__module_license__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module5:EJ(,4ELF4( WVS|$T$ D$(ufwD$,141u,D$$_O1ҋ;r 9Gָ9E[^_ÐD$@P%@3t1Ã|$ uD$ @u Ív1ÐhÉhÍ&'ah`01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo__ksymtab.comment@ t )@ %  /@4@:T9CM0Vp   1J- [_a`3l8 uipt_ah.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensematchcheckentryah_match__this_moduleinitipt_register_match_R4c7b317ecleanupipt_unregister_match_R27635291init_modulecleanup_module(,4ELF4( WVS|$T$ D$(ufwD$,141u,D$$_O1ҋ;r 9Gָ9E[^_ÐD$@P%@2t1Ã|$ uD$ @u Ív1ÐhÉhÍ&'esp`01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo__ksymtab.comment@ x )@ %  /@4@:T9CM0Vp   2K- \_b`3m8w| ipt_esp.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensematchcheckentryesp_matchinitcleanup__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module(,4ELF\4( SD$@ \$1Pf;r f;SFC1[Ð|$u Ív1ÐhÉhÍ&'length001.01kernel_version=2.4.19-pre9using_checksums=1author=James Morris description=IP tables packet length matching modulelicense=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.comment@p  )@ %  /4:  C0L<  5N _/e0p8}DT@/4DTipt_length.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensematchcheckentrylength_matchinitfini__module_author__module_description__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_moduleEJUZ(,4ELF4( D$L$P t- tUt&t+t6Dt&A8BÍvA8BÍvA8BÍvA8BÍvPh1Ã|$u1hÉhÍ&'ttl01.01kernel_version=2.4.19-pre9using_checksums=1author=Harald Welte description=IP tables TTL matching modulelicense=GPL<4>ipt_ttl: unknown mode %d GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@ 0 )@ %  /@4@:` C K=0mT  l 2K \bm8w| @+* ipt_ttl.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensematchcheckentryttl_matchinitfini__module_author__module_descriptionprintk_R1b7d4074__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_moduleu z(,4ELF4( T$PRu  $%R)AD$#YÃ|$u1át@HhÉhtHHÍ&'stateD01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@ @ )@ %  / 4 :49CpKt0T   4MDSDY8eTjto-  Ttipt_state.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatchcheckstate_matchinitfini__module_licenseip_conntrack_get_R51a42c8c__this_moduleip_conntrack_module_Rb0361033ipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module ' Uejuz(,4ELF4( UWVSt$l$$|$|$%fw/ PEPh t&/|$ u.jPV% =рt69s/zSPEPh`SviNǍPw)$EPh:t&F$9}/EPhjRQ1 u>>wt%Phh 5t&>N:L r:L v0FFPPEPh`t39v,SPEPh t& ^ˀ~uGF$9r-FPEPh+tqt`SEPh  >~t:t)FPPEPh`1 t&[^_]ÉUWVS\$|$l$(t$|$ fw/trPEPh Ov|$$uLuHjPW‰SS ƒ% =t1"f?tfu@tGPPEPh뱐t&|$$u~u=Gf9tSGPhh dGf9szISGPhh`'Gf9w= SGPEPhv[^_]ÉUWVS|$ l$\$$G 8T$D$|$(Hfwz|$0u.Phh f?t fGPPhh |9})|$0taVhh` L|$,uL|$0uEjVW߉‰UU ƒ% =t1Jf?tfu>tGPP|$8EPh G t.t|$0EPhz_ ?trtmthtct^tYtTtO0tJ8tEt@1t;9t6&P|$4EPh G 90;tt D$C|$t8;P|$4EPh  C9r9m;P|$4EPh` H&|u9-;P|$4EPh &4;T2;D$v2SP|$8EPh9[^_]YZÍvUWVS|$0\$4D$$ 9T$(D$ v9s-S|$<EPh WІĉƋD$(t$D$)ˉ\$L$$L$Ճ|$8t t[hh`DD$9 t&;tt D$ C|$ t/;P|$<EPhC9r3;P|$<EPht&|w9DP;P|$@EPh $t&4;T2;D$(v/ASP|$@EPh`9 t>GĨt4GP|$<EPhD$L$Ɓv+V|$<EPh@tG|$u t;fG% Pt$V|$@EPh |$u t>|$u7D$P|$<EPh` tR|$uRG=hGP|$@EPhW&|$tYT$)9sBth$)PV|$@EPh5 u0t |$8EPh 1G } tt;T$8R͉% Pt$VD$$PD$,PhvT$8R͉% Pt$VD$$PD$,PW7T$8R͉% Pt$VD$$PD$,PW[^_]ÍvT$jB\PB P Ð|$u Ív1Ðh@Éh@Í&'$$$$$  unclean 01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL(embedded packet) ipt_unclean: %sICMP len=%u too short ipt_unclean: %sICMP type %u len %u too short ipt_unclean: %sICMP error internal way too short ipt_unclean: %sICMP error internal too short ipt_unclean: %sICMP type %u not embeddable ipt_unclean: %sICMP type=%u code=%u ipt_unclean: %sICMP type=%u too long: %u bytes ipt_unclean: %sICMP PARAMETERPROB ptr = %u ipt_unclean: %sICMP PARAMETERPROB nonzero arg = %u ipt_unclean: %sICMP type=%u unused = %u ipt_unclean: %sUDP len=%u too short ipt_unclean: %sUDP zero ports %u/%u ipt_unclean: %sUDP len too short %u vs %u ipt_unclean: %sUDP len too long %u vs %u ipt_unclean: %sUDP fragment len too short %u vs %u ipt_unclean: %sPacket length %u < TCP header. ipt_unclean: %sZero TCP ports %u/%u. ipt_unclean: %sPacket length %u < actual TCP header. ipt_unclean: %sTCP reserved bits not zero ipt_unclean: %sTCP flags bad: %u ipt_unclean: %sTCP option %u after end ipt_unclean: %sTCP option %u at tail ipt_unclean: %sTCP option %u 0 len ipt_unclean: %sTCP option %u at %Zu too long ipt_unclean: %sPacket length %Zu < IP header. ipt_unclean: %sEmbedded fragment. ipt_unclean: %sIP option %u after end ipt_unclean: %sIP option %u at tail ipt_unclean: %sIP option %u %u len ipt_unclean: %sIP option %u at %u too long ipt_unclean: %sTruncated fragment %u long. ipt_unclean: %sOversize fragment to %u. ipt_unclean: %sDF set and offset=%u, MF=%u. ipt_unclean: %sZero size fragment offset=%u ipt_unclean: %sFirst fragment size %u < %u ipt_unclean: %sFragment starts at %u < %u ipt_unclean: %sZero protocol GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@  x )  % $ /4:9C@ K@0pT  `6OYJdmLw  @8  -   &E Q ipt_unclean.cgcc2_compiled.__module_kernel_version__module_using_checksumsinfo.1410check_icmpcheck_ipcheck_udpcheck_tcpmatchcheckentryunclean_matchinitfini__module_licensenet_ratelimit_Rf6ebc03bcsum_partial_R9a3de8f8printk_R1b7d4074__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module"3 8 C g     % DQ V a f     '9 > I         * 1r    " - 2^r w |     ct y ~    f      0 5 C Hn     * 8 =bt      H U  Z            0  5  C  b t  y            = [  `  n             ? X  ]  k  q          hltELFd4( UWVS\$L$$S )yI$4S\)fL$F 9~D$41&9vN 2uE)Ѓv3|u,fLfD 1f9r f;L$FЉ1/wB|t DBȃ9r[^_]YÃ|$t1ÉD$@P%@th`1øÐhÉhÍv'tcpmss01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value tcptcpmss: Only works on TCP packets GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@P 0 )@ %  /4:9C@ K0Tl  5NT3_8l(q8v-  (8ipt_tcpmss.cgcc2_compiled.__module_kernel_version__module_using_checksumsmatchcheckentrytcpmss_matchinitfini__module_licenseprintk_R1b7d4074__this_moduleipt_register_match_R4c7b317eipt_unregister_match_R27635291init_modulecleanup_module ).9>(,4ELF 4( D$tt PD$P҃É(UWVSD$PÃuD$ 2H*ClD$ C({`t hC\;v!PjS s ED$FD$fFfFFD$ PVF D$ @pF D$ @lFfF $‹v"AAA AIJufЃfF {`t hC\;vPjS kED$@EEfET$T$L${`t hD$|${\;vXPWS D$reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value 2@P`pfilterREJECT: ECHOREPLY no longer supported. GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.comment@P 8 )@ %  /4:9G@ C @ O 00 X   Hs5N` Sktxn88-  %8Sj 8Xd8ipt_REJECT.cgcc2_compiled.__module_kernel_version__module_using_checksumsconnection_attachsend_resetsend_unreachrejectcheckipt_reject_reginitfini__module_licenseip_ct_attach_Rec584387csum_partial_R9a3de8f8skb_copy_R00b41cc4___pskb_trim_R0870c3f3ip_route_output_key_Re5733d7fnf_hooks_R078b1fd2ip_finish_output_Rcc8ff864nf_hook_slow_R9ef2b397__kfree_skb_R2dd8a99cxrlim_allow_Rfe249a35alloc_skb_R1de2b30d__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909__ip_select_ident_Rb638b317printk_R1b7d4074__this_moduleipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3einit_modulecleanup_module ue $,3FdR &!U" !0 T\!.   #"%9>&(,4$TX\`dhlpELF4( UWVSl$4\$E |$1PT$P @D$D$T$D$ D$(T$T$,D$PSu$D$@ 9EuE(tHD$E(1[^_] SD$P J ZJZ [ÍvVS\$ C(pTtqFVABABAB A u x8V )ЉS\;C|sPRS SF4@PtS@8%hCpt Kpt S[^ÐVSt$ x(tvPtiP|$tAH Ywjjj P19&A @P=fBfQ ˈYPt&1[^ÍvD$t1Ã|$u1ÍvhÉhPQRZYXv'MIRRORl01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL<7>khm in MIRROR GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@P x )@ % D  /4:9C-K?0oT   5N[fu6l8(-  #=Ndx(ipt_MIRROR.cgcc2_compiled.__module_kernel_version__module_using_checksumsroute_mirrorip_rewriteip_direct_send.text.lock.ipt_MIRRORipt_mirror_targetipt_mirror_checkentryipt_mirror_reginitfini__module_licenseip_route_output_key_Re5733d7firq_stat_R903e93e1do_softirq_Rf0a529b7skb_under_panic_Rf4c660d4printk_R1b7d4074__kfree_skb_R2dd8a99cicmp_send_Rc333942e__this_moduleipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3einit_modulecleanup_moduleW"A Fa).:(,4ELF4( UWVS|$Y l$(C$:E1yitEtAy u;j QÃu1Bpt Jpt R[ fCfD$C$ ECffD$C PjD$P%fC  [^_]YÍvWVSD$\$L$tjQh1 [ ެuu1 tSh@!t(t#tttPhz1[^_Ívhu1øÉhÍv'TOS01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL<4>TOS: targinfosize %u != %Zu mangle<4>TOS: can only be called from "mangle" table, not "%s" <4>TOS: bad tos value %#x GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@ h )@ %  /@4@:T9C K@0pT  |< 2KR]8i|ns-  !|-ipt_TOS.cgcc2_compiled.__module_kernel_version__module_using_checksumstargetcheckentryipt_tos_reginitfini__module_licenseskb_copy_R00b41cc4__kfree_skb_R2dd8a99ccsum_partial_R9a3de8f8printk_R1b7d4074__this_moduleipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3einit_modulecleanup_moduleKv  ! = ` e}(,4ELF4( L$D$9tÍvWVL$ D$tjPh1 6!άuu1 tQh@1v^_hu1Ít&ÉhÍv'MARK,01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL<4>MARK: targinfosize %u != %Zu mangle<4>MARK: can only be called from "mangle" table, not "%s" GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@ ,H )@ % t /@4@:T9C K 0PT  , 3L)S,\^8kpu-  ipt_MARK.cgcc2_compiled.__module_kernel_version__module_using_checksumstargetcheckentryipt_mark_reginitfini__module_licenseprintk_R1b7d4074__this_moduleipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3einit_modulecleanup_module? DQ m r(,4ELF$4( WVt$ T$uu1 u#|$uD$uBu :u1^_ÐDUWVSt$Xl$d|$hz t D$PRËB @D$4D$8B @$D$DE\$ SVt?|$ t0SVt"|$ t 9Fu 1[^YËT$D$BÍvUWVSu}]SVu1Pt&EE 9Fs,CwۍEPVMtƋE ‰E 9FrԸe[^_]ÉUWVSu}]SVu1St&E1}D$Cw؍EPVtËE ‰E 9FrԸe[^_]ÍvUWVSu}]SVu 1OE1}D$Cw܍EPVJtNjE ‰E 9FrԸe[^_]ÍvUWVSt$l$|$ j +FPT$$uu7tt PPV1Q&=~Yh1ۃ;Xs/t hPhC;Xrҋ@PhfxM]}SC8u{=tCE}GCEf8t)҃R@PWMQw=t8CPCPCPCPUBPBPBPEPh`$PPEP}WVEPWz t1e[^_]ÃSD$P L$ $BčX|$wAD$fA4vA,D$fAD$D$:D$u4BPD$ PPBPuh1[YUWVST$$|$ȋX t$l$ $<u uf?t8u uft' u x=F7PF6PF5PF4PF/PF.PF-PF,PFPFPFPFPFPFPFPFPGPCPCPCPCPPCPCPC PC P$@\PtuPUDPh |D$$$R\)G9u3T$$RUD$$PD$$PV udzvXt5CPCPCPCPCPCPC PC Ph$ u x.1[^_]ShÃ|&h Ã}h؃[hh  uxt&ÍvS\$T$L$8uv=tD$Bf9t+D$ ЃPBPRQ=t9CPCPCPPT$BPBPBPD$ Ph`$[YPQRZYXMPQRZYXzPQRZYXPQRZYX)'    88 01.01kernel_version=2.4.19-pre9using_checksums=1parm_debug=idescription=Basic SNMP Application Layer Gatewaylicense=GPLOOM in bsalg (%d) 1` 8 8 8 111 %02x <7>bsalg: mapped %u.%u.%u.%u to %u.%u.%u.%u <7>bsalg: snmp version: %u <7>bsalg: community: %cgetget-nextresponsesettrapv1bulkinformtrapv2<7>bsalg: bad pdu type %u <7>bsalg: pdu: %s <7>bsalg: request: id=0x%lx error_status=%u error_index=%u <4>OOM in bsalg(%d) <7>bsalg: object: .%lu: type=%u <4>bsalg: parser failed snatdnatreplyorig<7>bsalg: dir=%s hook=%d manip=%s len=%d src=%u.%u.%u.%u:%u dst=%u.%u.%u.%u:%u osrc=%u.%u.%u.%u odst=%u.%u.%u.%u rsrc=%u.%u.%u.%u rdst=%u.%u.%u.%u <4>bsalg: dropping malformed packet src=%u.%u.%u.%u dst=%u.%u.%u.%u snmpsnmp_trapGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.comment@ |&  )` % * /@4@:` G  C * O00X - H#4$<U[eo )LKjjhl~ }.O@!PZ AnPo  M,Rt8C0 0<<#x9(q  9Kct<<x9 - @1ip_nat_snmp_basic.cgcc2_compiled.__module_kernel_version__module_using_checksumsdebugsnmp_lockasn1_openasn1_octet_decodeasn1_tag_decodeasn1_id_decodeasn1_length_decodeasn1_header_decodeasn1_eoc_decodeasn1_null_decodeasn1_long_decodeasn1_uint_decodeasn1_ulong_decodeasn1_octets_decodeasn1_subid_decodeasn1_oid_decodesnmp_convsnmp_tag_cls2syntaxsnmp_object_decodesnmp_request_decodesnmp_trap_decodemangle_addresshex_dumpfast_csumsnmp_parse_manglesnmp_translatenat_help.text.lock.ip_nat_snmp_basicsnmpsnmp_trapinitfini__module_licensekmalloc_R93d4cfe6net_ratelimit_Rf6ebc03bprintk_R1b7d4074kfree_R037a0cbairq_stat_R903e93e1do_softirq_Rf0a529b7ip_nat_helper_register_R5777fafdip_nat_helper_unregister_R0f85d948init_modulecleanup_module__module_parm_debug__module_description#-5.CH/[0-.-2/0X-0.-0.=-R0W.-0.A 0J 0X -m 0v 0{ . 0 - 0 .  /= 0 0 000JO/\a/ns//V^c/z//0 /K0T0|/-./'020;0RZ_/uz///AF/S0[0|0$/d111`gns/11./1%1>C3QV3di4y~4411149/G2W2g2w2 HL $(,048<@DHL ELF 4( UWVS|$l$$48)GPGPGPGPGPGPG PG Ph`Gă$PGPW%PЃPGPhGăf} hG@t hG t hGt%PhD$@tR$<tJh$<v#;PhC$9rhG P2$hGăw UhFPPh D$@tFPFPh  FPh/F ȃPh:~ } hFF @t hKF t hPF t hUF t hZF t h_F t hdF t hiFPhnD$@XF FhF v#3PhCF 9rhvhwGăw UhFPFPPhhGăpw UhXFPPh >w t9s Uh $t&FPFPh FPh&FPFPFPFPh|$ t+hjEPFPD$$Pjhf>utFPh[t& 2ȸEPhGău*wUhPh vPh[^_]ÐUWVS|$\$$t$(l$,0@ D$E$0 ‰T$D$PЅEPEREPhu{h-JtXfyftQB$;D$tH1fyftJB HfI:9DPPh2 BCF@f9|vh9j@\PD$PUh; uxu^[^_]YZËD$ |$ t 1Í8wxu1hu1øÉhPQRZYX땐t&$$$$$ LOG$\01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value SRC=%u.%u.%u.%u DST=%u.%u.%u.%u LEN=%u TOS=0x%02X PREC=0x%02X TTL=%u ID=%u CE DF MF FRAG:%u OPT (%02X) PROTO=TCP INCOMPLETE [%u bytes] SPT=%u DPT=%u SEQ=%u ACK=%u WINDOW=%u RES=0x%02x CWR ECE URG ACK PSH RST SYN FIN URGP=%u PROTO=UDP SPT=%u DPT=%u LEN=%u PROTO=ICMP TYPE=%u CODE=%u ID=%u SEQ=%u PARAMETER=%u GATEWAY=%u.%u.%u.%u [] MTU=%u ESPAHPROTO=%s SPI=0x%x PROTO=%u e0qqPq6< >%sIN=%s OUT=%s MAC=%02x%c GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rel.rodata.comment@ hP ) %  /4:9G @ C  O` 0 X  n 2KT Lf#r$8\(8-  3S_ipt_LOG.cgcc2_compiled.__module_kernel_version__module_using_checksumslog_lockrequired_len.1722dump_packetipt_log_target.text.lock.ipt_LOGipt_log_checkentryipt_log_reginitfini__module_licenseprintk_R1b7d4074irq_stat_R903e93e1do_softirq_Rf0a529b7__this_moduleipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3einit_modulecleanup_moduleD I{      & +B Ga f k      # (6 ;I N\ ao t      !1 6U ~      % *@ e jy ~        ? aks     1 6>D $(,048<@DHLPTX\`dhlptx| ELF 4( VSt$ P x t Rv f@pDj VjPPǃǃǃ[^ËD$Pt u xÐhÉVSt$ j PÃuDtPh@j VÃutVh[^ÍvUWVSD$,D$Pt L$;P\vt$@\D$T$|$D$ǻ0uWEL$A9sz`u)‰19v t$P6WE(Eƒz`u)t&19uz`t hJ\;vCPQR fCo;fCC sEt$Sr0L$@B@BCD$ B t$~ t{D Ixu t&B4|$$thD$$Hfft;t$p$;p t-fPw'L$$zUAftftt$$FfBT|$$tt$$zIxuB|$(tt$(z IxuB |$t*L$L$D$tft}vEHT$B9r vfC]U } uER uTx~Ht htht& u xD[^_]YZÐD$ |$,t1Àx+ux2w1ÐUWVS=vh@11D$׉D$ǀǀ ǀ| D$ C~hju.h t P1[^_]YÍvh  PPQRZYX;PQRZYXrPQRZYXt&ULOG D01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLauthor=Harald Welte description=IP tables userspace logging moduleparm_nlbufsiz=iparm_desc_nlbufsiz=netlink buffer sizeparm_flushtimeout=iparm_desc_flushtimeout=buffer flush timeoutipt_ULOG:nflog_rcv() did receive netlink message ?!? ipt_ULOG: can't alloc whole buffer %ub! ipt_ULOG: can't even allocate %ub ipt_ULOG: error during NLMSG_PUT ipt_ULOG: Error building netlink message Netlink buffer has to be <= 128kB GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@ 4H )` % | /@  4@:`@ C K 0P T P  5 3L- ]fs|}|+[ #D# 8h< @+ / 7'Sn,e$<Xqh&<ipt_ULOG.cgcc2_compiled.__module_kernel_version__module_using_checksums__module_licensenlbufsizflushtimeoutulog_sendulog_buffersnflognlulog_timer.text.lock.ipt_ULOGnflog_rcvipt_ulog_targetqlenipt_ulog_checkentryipt_ulog_reginitfini__module_author__module_description__module_parm_nlbufsiz__module_parm_desc_nlbufsiz__module_parm_flushtimeout__module_parm_desc_flushtimeoutulog_lockdel_timer_Rfc62f16dnetlink_broadcast_R42521f86irq_stat_R903e93e1do_softirq_Rf0a529b7printk_R1b7d4074ulog_alloc_skballoc_skb_R1de2b30dnet_ratelimit_Rf6ebc03b__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909jiffies_R0da02d67add_timer_Ra19eacf8__this_modulenetlink_kernel_create_R8ef74794ipt_register_target_R70b9d421sock_release_R73912d2dipt_unregister_target_R62fb2d3einit_modulecleanup_module "%.:CNT#Zdn$$$&()&() &lr$x''!*?G+,-$$)&)&!$'$q|&/ 0#1=B2GS1_%o%%HLT.ELF4( T$ L$D$$JPjR% YZÍvUWVSD$$|$41ۀyitE؅tEy u?j QÃu1L$$Bpt Jpt RD$$L$$֋B D$J\l$$)fL$ɊE 9t(tT$$@\Ph`nv?f|$fubF(uIh7x$(w,$L$$@(@$Ph@$D$fD$] \$T$ІfD$f&)uo؃)ȃv]| uVfT fD  f|$u f;T$I։D D$D EPD$P5PfEv| u  D \$9R~`u)‰1{j jF|)PVÃu"h vD$$Bpt Jpt RT$$[ \$$,L$$z`t hB\;vPPjR ]D$}H9s 4EPD$PD$"fD$"5PSfECD$$fCT$$SEPPj'M fEU f@ˆU EPE PQfE$L$Y߃A PRAPT$(fB fZ L$$@k[^_]ÐUWVS|$ t 1D$f8uD$$t h`T$BP%@ug1pjX9sDL$ًqQ Uuu1 1uR fDtth1[^_]hÉhÍTCPMSSDl01.01kernel_version=2.4.19-pre9using_checksums=1license=GPL<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <3>ipt_tcpmss_target: bad length (%d bytes) <3>ipt_tcpmss_target: no dst?! can't determine path-MTU <3>ipt_tcpmss_target: unknown or invalid path-MTU (%d) <3>ipt_tcpmss_target: unable to allocate larger skb tcpTCPMSS: path-MTU clamping only supported in FORWARD, OUTPUT and POSTROUTING hooks TCPMSS: Only works on TCP SYN packets GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@P  )@ % x /4:9C@ K@0pT    5NAZD'll8,<-  /Kdr,<ipt_TCPMSS.cgcc2_compiled.__module_kernel_version__module_using_checksumscheat_checkipt_tcpmss_targetipt_tcpmss_checkentryipt_tcpmss_reginitfini__module_licensecsum_partial_R9a3de8f8skb_copy_R00b41cc4__kfree_skb_R2dd8a99cnet_ratelimit_Rf6ebc03bprintk_R1b7d4074skb_copy_expand_Re8023aa0__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909__this_moduleipt_register_target_R70b9d421ipt_unregister_target_R62fb2d3einit_modulecleanup_module!~  6C H[u z *LU   -2=B(,4ELF 4(tD$Ph1ÉE({ pD@(tftU(B4PB,PuB$PB(PSE,PV;D$0u 1D$L$t%S D$  t'y֬uu1 u݅t D$ZE4@D$PSjU_t>E4PPE0hEE-L$/D$S  ҍ[^_]YZÐUWVSl$ EUPE41;8sQt8 0Sz0tPC PB0ЃC@4t HC@4HNjE4;8rE4P  [^_]ÃUWVSl$ 11 Y1L$t1\t1F9rCPhgD$ P ;D$$w ˍL$D$)0[^_]Yù B``d`Bh|TPjhk t@ uh@$h1ÍÍvhPhkPQRZYX6vVPQRZYXPQRZYXPQRZYX$2PQRZYXBI5JV J  ERROR`b$`bx01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLarp_tables: error: '%s' arptable_arpt_arptables: loop hook %u pos %u %08X. %s arp_tables_namesarp_tables: (C) 2002 David S. Miller  QP1XYXQP1XYQP1XYQP1XY Z(8arpt_register_table_Rd419a7d0arpt_unregister_table_R510e4b20arpt_do_table_Ra502745carpt_register_target_R07f87aeaarpt_unregister_target_Rcf45066eGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.kstrtab.rel__ksymtab.comment@P -x)  % @3H/4:9C  OHK 3( Z((V 3P e` r (n 4P|H0x #) (5NYeq|Ll,`8 hT     t( 13TC$SSxc@ r8,0! -  *&BNg{X95CXa Dl  @ ` -V!  0!arp_tables.cgcc2_compiled.__module_kernel_version__module_using_checksumsarpt_mutexarpt_targetarpt_tablesarpt_errornulldevname.1188.text.lock.arp_tablesfind_inlist_lockmark_source_chainstranslate_tablearpt_standard_targetreplace_tableget_counterscopy_entries_to_userget_entriesdo_replacedo_add_countersdo_arpt_set_ctldo_arpt_get_ctlbootstrap.1261arpt_error_targetarpt_sockoptsarpt_get_tablesinitfini__module_licensenet_ratelimit_Rf6ebc03bprintk_R1b7d4074arpt_do_table_Ra502745cirq_stat_R903e93e1do_softirq_Rf0a529b7__down_failed_interruptible__up_wakeuprequest_module_R27e4dc04__vmalloc_R79995c5b__generic_copy_to_user_Rd523fdd3vfree_R2fd1d81cnum_physpages_R0948cde9__generic_copy_from_user_R116166aaarpt_register_target_R07f87aea__this_modulearpt_unregister_target_Rcf45066e__down_failedarpt_register_table_Rd419a7d0arpt_unregister_table_R510e4b20sprintf_R1d26aa98nf_register_sockopt_R27df8879proc_net_R7a4689f1create_proc_entry_Rd8ee2b5bnf_unregister_sockopt_Re9a21e2dremove_proc_entry_R3a97d148__kstrtab_arpt_register_table_Rd419a7d0__ksymtab_arpt_register_table_Rd419a7d0__kstrtab_arpt_unregister_table_R510e4b20__ksymtab_arpt_unregister_table_R510e4b20__kstrtab_arpt_do_table_Ra502745c__ksymtab_arpt_do_table_Ra502745c__kstrtab_arpt_register_target_R07f87aea__ksymtab_arpt_register_target_R07f87aea__kstrtab_arpt_unregister_target_Rcf45066e__ksymtab_arpt_unregister_target_Rcf45066einit_modulecleanup_module) *A k,,,0 * f l  r     , , ,: ,@ , 1> ,X ,^ , 2Z 2 3    4151 32353>31 5)/ 5M,,,3!' -2e7k7qwNO7777!'=I7O7e7k71773&707AK{377377 <17BKQV\ajpu{=> ?@7 *@> A-&.0/:.D/N/[-k-{-///-//./9/./9/.$/.98/  $4D  $:B; D+F6H 8$JELFL4( SL$\$ T$D$jhPRQS[ÉShÃ|Bh<Ã| hTÃ}h<h؃[VS1<&SFvh[^Í&'filter$$@ERRORERRORfilter01.01kernel_version=2.4.19-pre9using_checksums=1license=GPLGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.comment@ ) % /4:9C0L,  T":Sa<o&y<0(X2- 9(XE2arptable_filter.cgcc2_compiled.__module_kernel_version__module_using_checksumsinitial_tablepacket_filterarpt_hookarpt_opsinitfini__module_license__this_modulearpt_do_table_Ra502745carpt_register_table_Rd419a7d0nf_register_hook_Re64eb24bnf_unregister_hook_R9269e08aarpt_unregister_table_R510e4b20init_modulecleanup_module*/=BPUchpu(8D\ELF4( UWVS|$l$_G 9tAtD$PSՃt$SP u x# [G 9u u x 1[^_]ÍvWVS|$G u/x #t&CjC PCPSjjW'à uG u x [^_VSt$hj(Ãu 1eCCCC D$C$D$CCC C C CSD$Pj }S1[^ÐUWVS\$l$|$j j ƃuhOF~ nuU BFBFB FC9|; u x Ph {u{t{t {u{ t  xL VC$Љƒ~5C pC Fs  ux &\ ux t&u-CPh`CCCC Sq V[^_]ÍvS\$jC  u x S"S[ÍvUWVSl$\$Uw1C׉p\)y09y`uQ\jRQv Cy`u)‰19~xj WA|)‰PQƃuhCP tB(FxV džBdSBpt Jpt RsSz`th&z\;vPWR Cu EtftCC xu3CP C8BuC9BuC9B tCP &1[^_]ÐVSt$>v lFPh8 D$Pà uCCFt;D$uSV}CCPC PCPS1[^ÍvWVSL$t$|$ D$D$1fy u zt w rt&D$ttAVttGAA ?vAFA =v+A ">wGPVQà [^_YÐWVS|$t$CjC PCPSVhH WDà u[^_ÍvD$T$L$ RPQ Ë UWVSt$$D$Bt ~;t 4X9L$ B Qt;B\v R\T$D$\$[ 1j SŃD$D$E`u +L$1ɉ9nt hU\;vPRU T$fBfBB BӃ1L$ JD$CDA@CA@C ACA @CA p t ׃$uCT$ B pt {$uC$L$ A@tfC4A x t4A@t*@dfC6QJ4tC9PR4ЈC8|$t(T$ L$B{HD$tftT$+L$ ED8t&tEpt Mpt Uh1[^_] ÃT$$PRƒtj@@PRP$YÍvUWVS 1l$T&ZE19t$ƋMhEFFvRt$"V\9{ tCƒftj t jt&{GvjFIuju Qt*yu$C 9tPAPh PC BBF\PPCPP}PCt jSV FptL$IpVvt x\S[^_]YÉ|$uD$ @ip_queue: OOM in enqueue <4>ip_queue: full at %d entries, dropping packet(s). <6>ip_queue: peer %d died, resetting state and flushing queue <4>ip_queue: OOM in mangle, dropping packet <3>ip_queue: error creating netlink message <4>ip_queue: peer pid changed from %d to %d, flushing queue ip_queue_maxlenipv4netPeer pid : %d Peer died : %d Peer copy mode : %d Peer copy range : %Zu Queue length : %d Queue max. length : %d Queue flushing : %d Queue terminate : %d <3>ip_queue: initialisation failed: unable to create kernel netlink socket <3>ip_queue: initialisation failed: unable to create queue ip_queueGCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.comment@@  @ ) % \$@ /4: C@  K`0T ' O 3L}Xw lv(Al(8 EH / X< A1 I< WeXopX}X\   Kf  &J[s*GK_y 6Ies@&4 @ Kip_queue.cgcc2_compiled.__module_kernel_version__module_using_checksumsipq_dequeue.text.lock.ip_queueipq_flushipq_create_queueipq_enqueueipq_destroy_queueipq_mangle_ipv4ipq_set_verdictid_cmpipq_receive_peeripq_dev_dropdev_cmpnetfilter_receivenfnlnetlink_build_messagenetlink_send_peernetlink_receive_user_skreceive_eventsysctl_maxlenipq_tableipq_dir_tableipq_root_tableipq_get_infoinitipq_sysctl_headerfini__module_licenseirq_stat_R903e93e1do_softirq_Rf0a529b7nf_reinject_Ra6c87350kfree_R037a0cbakmalloc_R93d4cfe6nf_register_queue_handler_R971357abprintk_R1b7d4074net_ratelimit_Rf6ebc03bnf_unregister_queue_handler_R4df6e6de___pskb_trim_R0870c3f3skb_copy_expand_Re8023aa0sock_wfree_R5226dcc8__kfree_skb_R2dd8a99c__out_of_line_bug_R8b0fd3c5skb_over_panic_Ra9587909ip_route_me_harder_Rbc9709c1nlqalloc_skb_R1de2b30dnetlink_unicast_R3f3b76eertnl_sem_R93ffbd01__down_failed_trylocknetlink_ack_R02aecd9a__up_wakeupipq_dev_notifierproc_dointvec_R2de43772sprintf_R1d26aa98netlink_kernel_create_R8ef74794sock_release_R73912d2dproc_net_R7a4689f1create_proc_entry_Rd8ee2b5b__this_moduleregister_netdevice_notifier_R63ecad53register_sysctl_table_R9668c988unregister_sysctl_table_R7e7e1a0fremove_proc_entry_R3a97d148unregister_netdevice_notifier_Rfe769456__module_descriptioninit_modulecleanup_module''D'f'''')*''+t,*+ -'''!.1 6-a'g''''' -*0/9'B'H'`*01 $-N2l3456E)*''')*7T845 3&  + -] 7h o 9 : :h 7  - 7 7 7 < 3 : :" L 7m 's 7  @ ' '  A   -! + 0 : 7F  K -P \ Bq Cy  ~ D  7  B E > F  G   H C   I > J 7# / B{ ( ( ( ( ( ( ( ( ( (;"=/( 0?t  ELF(4(UWVSl$|$t$111؋t+;u;u9u B@Xu1ًt(t&;u9u B@Xuݍ@Åt9;t;uu9u B@Xu;uыt&9u B@XuuXu1 `[^_]ÉVST$ 1E3t%=t11[^ÍvS\$S‹ u x[ÍvS\$S]ƒ:t69u) ux ƒ:u[ÍvUWVSl$1ɸ]0},u1Eȅt%=t1؃1;u;u ;9uރ|$ u1% hhÃu  1t&1󫍃HD$ChLC4耉D$ ljƃƉ߬u;uUt&GcWhSSudtLT$L$CꀉBCBC B S|t$VD$S  1[^_]YZÐ|$t  S\$ChPt S[ÍvUWVSl$$:D$EL$pD$Zt@ t ZB L؋E`m\)ʼn9|$ t!|$| yt&uq t T$D1PG PGP=ƒ tIt?%=t3u|$ t#+Bl= wBhBhBl[^_]YZÃUWVSt$$fD$1D$N\+V`9v9)PVF D$T$*@j}k~ku'Vd%fD$ftFk~ku3jF\PjV‰Vd%FkfD$ t T$tD$ȉD$ST$ BPB Pà F F$F`V\)9v)PVu1)~\F ~,1~ku(jV$F )PR щVdB9C‰FdT$BfFtFj} f|$u }C8Ct/tSptD$)yC@Ct&T$BSpCF\CCFF(tHF(t„t P@ЃdžT$B$<uTFtfu/N Y$<u<A P=fBfQ Yf=uV $<uJV-t&jjjVFpt Npt V1[^_]Ív8UWVSD$P\$L@hD$,L$,D$(S T$$AdpqdtA,ED$PtD$T$ L$,t$,ƠIxL$t$ D$ hu0C(uT$,BPvf{tD$0hxL$ IL$tf{tu D$$@D$d$L$ t$,T$0T$|$4I L$1t$l$4t$8T$@D$$D$DD$4PT$Rt L$,ALBT$0r ;t$PutJt$,F,"D$ hftL$,R$Ax)C(tP$D$PP`f{tuWC(t ;P$sC~P$L$$A@ ft1A9}$RjjSD$@HD$,Ph~?L$,+Al= w!JQhC(t!@`t@tSЃ D$,@hC CT$Ff$4C|)9|+1ɀ{itEȅu CpVSƃu6D$0tHt$(FCptKpSS tB(FxV džBdCpt Kpt S󋃀+D$T$S\;C|sR PRS C {,1C(tHD$0{ C(EfoG /Stfu L$$Afu t$$T$t$ˆWD$0@lGD$0@pG T$ BGuf{tu L$$AvGt$,fGCtfGD$,Vxrt@tL$,pȉqtBrD$, t T$,}4C\WjPR% ft„t P@Ѓǃs\C\CkfGD$0G@t fG PWW=u1C(@$9C\vhS2S!t&hXD$4@ PjSjjtu L$(q A t$(FF@D$,Hd1?@`t @tSЃT$(BCpt Kpt SL$,1Id[^_]8Ívf¿D$,f D$.@s|$@t@fT$>D$, uD$0D$. uD$4PSƃ|$P`t\$P9^D$D$PL$Hph%=u DT$L$PAX1ШVD$HD$LD$4D$8D$D\$PCxD$HCpVStzD$u D$@D$9D$>fD$T4x!9P ؅u DD$D$D$ED$D$!D$H|$PuvT$TD$4\$r9P ȅu 1 uKD$jSƃt2D$`t"vt$P\$PSD$D$ D$ [^_]<ÍvD$@hÐS\$L$ ShC~ +Bx9~K`1[ÐD$ǀǀǀ(@Dhǀ ǀ tf@d f@f8@`f@XHh@@ƀPxPpÉ0UWVSD$DD$$D$ D$D$phPJotmWT$ |$D$$\$(|$,D$l$,D$0T$8T$T$GRE over IPv4 tunneling driver <6>ipgre close: can't remove protocol QP1XYzQP1XYdQQP1XY|fS(0GCC: (GNU) 2.95.4 20011002 (Debian prerelease).symtab.strtab.shstrtab.rel.text.rel.data.bss.note.modinfo.rodata.rel.fixup.rel__ex_table.comment@ $'h)@ % *(/  4 :49C O @K *( Z`(V *P e0n& ! 1JH^Ps`"$]5M n-)A(SX(^   qh t+z-  )7I[w 6I]s3Faw.;,,Jfip_gre.cgcc2_compiled.__module_kernel_version__module_using_checksumsipgre_fb_tunnel_devipgre_fb_tunnel_initipgre_fb_tunnelipgre_lockipgre_tunnel_lookuptunnelsipgre_bucketipgre_tunnel_link.text.lock.ip_greipgre_tunnel_unlinkipgre_tunnel_locateipgre_tunnel_initipgre_tunnel_destructoripgre_tunnel_uninitipgre_tunnel_xmitdo_ip_sendipgre_tunnel_ioctlipgre_tunnel_get_statsipgre_tunnel_change_mtuipgre_tunnel_init_genipgre_fb_tunnel_openipgre_fb_tunnel_closeipgre_protocol__module_licenseirq_stat_R903e93e1do_softirq_Rf0a529b7__this_modulekmalloc_R93d4cfe6sprintf_R1d26aa98__dev_get_by_name_Rab0b79e8register_netdevice_R1594fa50kfree_R037a0cbanetdev_finish_unregister_R4e0b74a2ipgre_errjiffies_R0da02d67ipgre_rcv__pskb_pull_tail_R05ed4bf5skb_checksum_R3a55f9f1csum_partial_R9a3de8f8netif_rx_Rc8e19da1icmp_send_Rc333942e__kfree_skb_R2dd8a99cip_route_output_key_Re5733d7fskb_realloc_headroom_R4388fd4esock_wfree_R5226dcc8skb_under_panic_Rf4c660d4sysctl_ip_default_ttl_Rf6388c56__ip_select_ident_Rb638b317ip_send_check_Ra37b7441nf_hooks_R078b1fd2ip_finish_output_Rcc8ff864ip_fragment_R0c6d67fdnf_hook_slow_R9ef2b397netdev_state_change_Rb86936baunregister_netdevice_R9595e0b9__dev_get_by_index_R1b5d7a36init_moduleprintk_R1b7d4074register_netdev_Rc1644cbeinet_add_protocol_R02898fadcleanup_moduleinet_del_protocol_R9d48fec9unregister_netdev_Re6fb46df+c z&&&&&&](()((8>*D+{,-((((.00[23i24567Q 8 6% 0 9 7 :( 7N V ; < 4 = > ? ?+ @1 AB @Q e B 7 ( (J":C$7DN(X(8E((((G H I-2K>CGKPLh@nAx@''4d1/, $,<  $/lib/modules/2.4.19-pre9/kernel/drivers/block/loop.o: /lib/modules/2.4.19-pre9/kernel/drivers/block/nbd.o: /lib/modules/2.4.19-pre9/kernel/drivers/block/rd.o: /lib/modules/2.4.19-pre9/kernel/drivers/char/i810_rng.o: /lib/modules/2.4.19-pre9/kernel/drivers/char/nvram.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/bsd_comp.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o /lib/modules/2.4.19-pre9/kernel/drivers/net/dummy.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/eepro100.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/mii.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ns83820.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_async.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_deflate.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/slhc.o /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_synctty.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o /lib/modules/2.4.19-pre9/kernel/drivers/net/pppoe.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/pppox.o \ /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o /lib/modules/2.4.19-pre9/kernel/drivers/net/pppox.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/ppp_generic.o /lib/modules/2.4.19-pre9/kernel/drivers/net/sis900.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/slhc.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/sundance.o: /lib/modules/2.4.19-pre9/kernel/drivers/net/tulip/tulip.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/ip_gre.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/arp_tables.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/arptable_filter.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/arp_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack_ftp.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack_irc.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_nat_ftp.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_nat.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_nat_irc.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_nat.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_nat_snmp_basic.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_nat.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_queue.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_LOG.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_MARK.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_MASQUERADE.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_nat.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_MIRROR.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_REDIRECT.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_nat.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_REJECT.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_TCPMSS.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_TOS.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_ULOG.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_ah.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_esp.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_length.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_limit.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_mac.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_mark.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_multiport.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_owner.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_state.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_tcpmss.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_tos.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_ttl.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ipt_unclean.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_filter.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_mangle.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/iptable_nat.o: /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_conntrack.o \ /lib/modules/2.4.19-pre9/kernel/net/ipv4/netfilter/ip_tables.o /lib/modules/2.4.19-pre9/kernel/net/netlink/netlink_dev.o: # module id=string # pci module vendor device subvendor subdevice class class_mask driver_data i810_rng 0x00008086 0x00002418 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 i810_rng 0x00008086 0x00002428 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 i810_rng 0x00008086 0x00002448 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 i810_rng 0x00008086 0x0000244e 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001229 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001209 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00002449 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001029 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001030 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001031 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001032 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001033 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001034 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001035 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001036 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001037 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001038 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001039 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x0000103a 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x0000103b 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x0000103c 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x0000103d 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x0000103e 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001227 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00001228 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00002449 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00002459 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x0000245d 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00005200 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 eepro100 0x00008086 0x00005201 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 ns83820 0x0000100b 0x00000022 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 sis900 0x00001039 0x00000900 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 sis900 0x00001039 0x00007016 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000001 sundance 0x00001186 0x00001002 0x00001186 0x00001002 0x00000000 0x00000000 0x00000000 sundance 0x00001186 0x00001002 0x00001186 0x00001003 0x00000000 0x00000000 0x00000001 sundance 0x00001186 0x00001002 0x00001186 0x00001012 0x00000000 0x00000000 0x00000002 sundance 0x00001186 0x00001002 0x00001186 0x00001040 0x00000000 0x00000000 0x00000003 sundance 0x00001186 0x00001002 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000004 sundance 0x000013f0 0x00000201 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000005 tulip 0x00001011 0x00000002 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000000 tulip 0x00001011 0x00000014 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000001 tulip 0x00001011 0x00000009 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000002 tulip 0x00001011 0x00000019 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000003 tulip 0x000011ad 0x00000002 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000004 tulip 0x000010d9 0x00000512 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000005 tulip 0x000010d9 0x00000531 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000006 tulip 0x0000125b 0x00001400 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000008 tulip 0x000011ad 0x0000c115 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000009 tulip 0x00001317 0x00000981 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x00001317 0x00000985 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x00001317 0x00001985 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x000013d1 0x0000ab02 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x000013d1 0x0000ab03 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x000013d1 0x0000ab08 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x0000104a 0x00000981 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x0000104a 0x00002774 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x000011f6 0x00009881 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000b tulip 0x00008086 0x00000039 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000c tulip 0x00001282 0x00009100 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000d tulip 0x00001282 0x00009102 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000d tulip 0x00001113 0x00001216 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a tulip 0x00001113 0x00001217 0xffffffff 0xffffffff 0x00000000 0x00000000 0x00000006 tulip 0x00001113 0x00009511 0xffffffff 0xffffffff 0x00000000 0x00000000 0x0000000a # isapnp module cardvendor carddevice driver_data vendor function ... # usb module match_flags idVendor idProduct bcdDevice_lo bcdDevice_hi bDeviceClass bDeviceSubClass bDeviceProtocol bInterfaceClass bInterfaceSubClass bInterfaceProtocol driver_info # module pattern # ieee1394 module match_flags vendor_id model_id specifier_id version # module id ELF4P4 (hhhhhL%10#'%,$"*+/.- ()!&XD    h |HPXP % b'" m /$ * / . 5J#"xt \ u[^ÐUS[Ø[ÍUS[|[Unknown code ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_: hT  -   S X`DXoooXo"2BRbrh.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss ` S!oXXb.o0= XF DD` O%JU0[ ah ihho||yHHPPXX\<ELF484 (444DDx`H6HFHFaj^P:bD&W@8+YO]6!><c7ZfKEe[gUhL3F?59d\"_J(1CQV=)iN2#Ta,$%.40/;* HB'-ASXMRI`Gh .D<d  0. `. D DFHFG G(G@Hr |g|EL![ HF((\  '' b'"]=&- 8&7% */O6&#% x> p+z #3 ,F /<.-: 45,7J#"-/ Pj &H @ yV$ =V[[ X <-7 + e8H   *G?G@GAGEGFGHGKGLGMGNGPGRGSGTGUGVGWGXGZG\G`GaGcHeHfHg HiUS[3g[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhUS[,0 t[ÉUS[/udt.0PЋ8u⃻tPNǃ]ÍvUS[t/[ÉUS[\/tPP]ÐUS[$/[ÉUS[/u [ÉUWVS[.EEj4Aƃ}u j,E@EEUExtt&EUE<uUPEPEUDE4UE FF FjFEF }эAPjFURPj EPv8F$f(jj‰V EBUEe[^_ÉU WVS[^-U4vzv o F8t }WF0EP_F8uv9V0e[^_Ít&UWVS[,UMEpuuQu VjRtgэMNPǃuPjVV8PWWjMQ WxuFujhm EP8ujhm \EM<֋E xэD1Paǃ UBM4WOPW u vW PW jWOƃW EUBM<?u ~эAPEǍfE pUR{ MQjuVEP {t&ǃtt7HP0URHIxPjMQ/0jVV1j9ue[^_ÐU WVS[:*E<} u=tEm U RtMPwE>tEE<uUPV4ƃuGUFwED} QUE P4 Ue[^_U WVS[>)U}p>tCE P6u >tF>u>um e[^_Ðt&UWVS[ú(EEUEU PUP Ex?tmEt&7>tIUR6u,UBrEPURE PGЋUB1>uE}Ex?um e[^_ÐU WVS['}p >t-t&WE0E P6u1t&>uظm e[^_ÍvUWVS[Ò'1E EUU8tGEPUxuPE19t&E EF9~URWuƃuVe[^_UVS['uU B< t< t:!u,@(t m Vt&BR*Dt&EPRVEUt%EPRVƃu1e[^Í&UVS[[&68pG6]e[^ÉUS[&0j /Pj jXPU!WVS[%8TU`8ǃ@,VzjV PVjXPd'PjM\ PPejPjR !jVj 9u0h Vǃ9t'DžXm jt&Ej Wt9t~jgWMQ =m uWF< t< tj V~tj VitV8PjEP`z,DžX\QjXd'󥋅T8X8[^_ÐUVS[v#Mu @,p0[^ÐUS[@#ju] UWVS[ #u jEuexP90EPU1UBPjEPoURE1UEEet&< t< uFL<"uEw EUPEPEU"u "GFt&E &FG}trUEEe[^_Í'U WVS[J!E4Vu6>Qǃu1x6Wgv>MʋMPhlj:t BA:u A(AV:t BA:u)Ae[^_ÉU WVS[z uuAVEPE PW We[^_US[4 uPu u]Ít&'US[UM H[ÐUS[U@[ÐU WVS[êE41F 8t vG<uPv F uUKG9E~E~;M|t&V DI;M}F U MF DEe[^_UWVS[U} um H ʃ9t9t :u[^_ÍUtkt&>IQ6RmD~tPPh>u~@RP>RPDžƅ +PRPrP RPRP+ :p:DPRv Pj[^_ÍvUVS[ëuVDt Et9u'juu jgvuFe[^ÉUWVS[+}( ,0$VF~jjWjj jW;jWj >u (Pu,j00\P$PjjP$Pjу06US[Up0P]ÉUS[U0*PV]ÐUS[èUp*P]US[p.Ph m u]ÐUVS[;t Ѓ>u[^ÐUS[[ÍUS[[Sorry, this request is not yet implementedShell escapes are disabledNo info availableRequest table not foundPermission deniedEnd-of-file reachedCommand line abortedCommand not foundNo info directoryNo current invocationVersion mismatchSubsystem aborted.helplhlist_help?lrlist_requestsqquitababbreveexecutesubsystem_namesubsystem_versionReturn the version of this subsystem.Return the name of this subsystem.Produce a list of the most commonly used requests.Execute a UNIX command line.Enable/disable abbreviation processing of request lines.Leave the subsystem.List available commands.List topics for which help is available.Display info on command or topic.Identify the subsystem.: couldn't allocate memory to print usage messageusage: %s [topic|command] or %s couldn't allocate memory for help filename/.infoNo info found for Can't fork for pager$Header: lib/ss/SCCS/s.listen.c 1.16 02/03/07 23:52:55-05:00 tytso@think.thunk.org $Unknown request "%s". Type "?" for a request list.Can't allocate storageUnbalanced quotes in command line%s wAvailable %s requests: , PAGER%s version %s %s Copyright 1987, 1988, 1989 by the Massachusetts Institute of TechnologyD$GV/E//// /......`.Dm ////////////////E1E1$E`10E.1@E1LE0XE0dE0lE@0tE0|Emorehx < 0.h   (GD@ooo.o5HFz *:JZjz *:JZjz *:JZjzD.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss 4 h h !o...o@= DD@F  O<<%JddU@[0.0.a`.`.` iD4oDFD6yHFH6G7 G 7(G(7@H@8 @8ELF4|34 (--000l1l1l1CIFH/ 9=8';!7,<DB6G5+A43C*>#01:?"%@E(-2&.)$\ 0 `      0% `% 0 h1l142<2D225@ 9 l1 b'"P#3 7]*x e-n-/ 5` J#"X$y "c  2" w/*#3 50% ,)`` T|;{"DW=[b  ; 2~ D24=X!+ l#% b *!w L _DYNAMIC_GLOBAL_OFFSET_TABLE___gmon_start___init_fini__cxa_finalize__deregister_frame_info__register_frame_infoe2p_feature2stringsprintfe2p_string2featurestrcasecmpstrncasecmp__strtol_internal__ctype_be2p_edit_featuremallocstrcpyfgetflagsopenioctlclosefsetflagsfgetversionfsetversioniterate_on_diropendirreaddirclosedirfprintfgetpwuidgetgrgidstrcatlist_super2strncpye2p_is_null_uuide2p_uuid_to_strprint_fs_stateprint_fs_errorsctimelist_superstdoutprint_flagsfputslibc.so.6_edata__bss_start_endlibe2p.so.2GLIBC_2.1.3GLIBC_2.0si *ii 6000 0,080D0P0\0h0t0000000000000000011 1111$1(10141<1@1H1L1T1X1222$2&222?2GP2T2X2\2`2d2h2 l2"p2$t2%x2'|2(2)2,2/21222324252:2=2@2A2B2D2E2F2HUS[`%[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h US[X#t[ÉUS[(#udt.􋃄0PЋ8u⃻t$P ǃ]ÍvUS[à"[ÉUS[È"tP$P>]ÐUS[P"[ÉU WVS[6"MU t;u;Pt/ xutt !tCt&IR @3v?1t &AuQPWVe[^_U WVS[Î!}t!vWda ~ujPWnSGC/C+␍&T D 4 T D 4 E t&U t&E  tAW Ejj PR w)E8u! U FU1 t&e[^_ÍvUVS[M9t A9t DP u[^UVS[ËMEt4DP u"},tAEtDP u},u[^ÉUWVS[.}QKƃu MQV{>EVƃV0ǃ ?u 1 <-t <+t <^uEFEPEPVRuUE}t M]}t ЋM !M 1twt >T1e[^_É'U WVS[huƃt)EPhfVNjUE Ve[^_Í&'U WVS[æhu{ƃt'E EEPhf@VǃVNe[^_U WVS[Fhuƃt)EPhvV/NjUE Ve[^_Í&'U WVS[huƃt'E EEPhv@VǃV~e[^_UVS[wu EPhfuu‹EЍe[^ÐUVS[;u EPhvu9E1e[^ÍvUWVS[URu/QCEPRMQU ҃QƃuP-1[^_U WVS[V} uVPW3VJ uPW0PWe[^_ÉU WVS[} uVPWV uPWt&0 PWe[^_ÉU WVS[z}ƃuE'vKX)ʍA)Ǎ!~PQ"PEPW: vvMn)‰))ǃ!~PQ!t-P0PV VEPQvr\))ǃ!~PQ!t-P]É'UWVS[&}EEEpptjE #tB}t,}t EWCPMWv"Wv&}uWFP >u}t}tWHPe[^_Ít&'U WVS[V}u t L SPW t^PWe[^_Í'US[EU UURhf@P]ÐUS[ôEU UURhv@P]ÐUE1Ҋt1 B~ÍvUVMu Q Q Q ЉQA fFQA fFQA fFA F AfF^ÉU VS[ u EPujEPEPEPEPEPEPERf%PEPEPu|PVe[^ UVS[W t Ѓ>u[^ÐUS[$ [ÍUS[ [journal_devneeds_recoveryfiletypecompressionbtree_dirlarge_filesparse_superresize_inodedir_indexext_attrimagic_inodeshas_journaldir_preallocFEATURE_%c%dFEATURE_%u (user unknown) (user %s) (group unknown) (group %s) s%d month%s, %s%d week%s%s%d day%s%s%d:%02d:%02dI E.ųFilesystem features: %s (none) Filesystem volume name: %s Last mounted on: %s Filesystem UUID: %s Filesystem magic number: 0x%04X Filesystem revision #: %d (original) (dynamic) (unknown) Filesystem state: Errors behavior: LinuxGNU/HurdMasixunknownFilesystem OS type: %s Inode count: %u Block count: %u Reserved block count: %u Free blocks: %u Free inodes: %u First block: %u Block size: %u Fragment size: %u Blocks per group: %u Fragments per group: %u Inodes per group: %u Inode blocks per group: %u Last mount time: %sLast write time: %sMount count: %u Maximum mount count: %d Last checked: %sCheck interval: %u (%s) Next check after: %sReserved blocks uid: Reserved blocks gid: First inode: %d Inode size: %d Journal UUID: %s Journal inode: %u Journal device: 0x%04x First orphan inode: %u ContinueRemount read-onlyPanicUnknown (continue)No_TailmergingtJournaled_DatajCompression_ErrorECompression_Raw_AccessXCompressed_Dirty_FileDCompressed_FileBCompression_RequestedcNo_AtimeANo_DumpdAppend_OnlyaImmutableiSynchronous_UpdatesSUndeleteuSecure_Deletions, ---- clean not clean with errors%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x0@2%%%% %%%%%%{%l%`%,u,s,j,h,T,R,H, F,:,@8,0,.,%,#, , ,+++++++@++++ 0%\ @ D2 ` o0 oo o,l1 & 6 F V f v &6FVfv0.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss 8 \\@!o .o0 0 0= ` ` F   O %J UP[0%0%a`%`% i00hoh1h1yl1l14242<2<2D2D222 2ELFA4/4 ('''77L+L;L;;e5 J 0*G %{fF D mt#n~. R]Py'd`K@}x[j2sZNA\3,":<&!_UE=Mgo1lcqiwOTW/(^k+I|4hB$uHSvQa?8LCpb7Y>Vz)9Xr6- .P00489 A P  7 H;L;<$<,<x>T  1 9 m@ q   I H  \%  `  8`e> 0  'K Lh 8  g  \ {p K  |a   ^ & md \I  $ v$`U /P8 eC -$ L;JhQV  ,1 p9 b'"=I@C  T 1 P 8B& ؙ  _ | D7 V(K \4O *o  \q s7!  P' M \g bt  'p7 xm'   u `  t  T CV eu1 nx^ , B& '  & hxC  D O G /8p}  3 $xC mHP  5v $ io G W H9 J#" p T:X  9 A@j X9 8 v` \ < r 6 7q r 1 M doe m    <  cw=  ,h ?D  A  |B& Iz t( Nd f  P x' 6 `1 8Np dd  DG   B& (w Zi  LL^ tT tLpL d! v XB# 5U| x>M 7,  g4q Q }8 M  9 b [ ȝ ]`lD R / ȯ  @ !,U D` / cX <W [ 5P V=;@F Z   4\h]X  -|p N   &  Y Ȫ6 \Y  |\b ;{"0B& 0 W0 1]S 3=E ܐm QK t] C H . Л 5  c ; & ȫq o @ *x> ,<=D>S =$`y hv+ LO z`x  1 E]e- p5  D  i~ B] n{ d w 0& 6' B Դ.  ? }* ؞L .C#  : ` tb xK X& EwA oG "L  3=  (i( L  _DYNAMIC_GLOBAL_OFFSET_TABLE___gmon_start___init_fini__cxa_finalize__deregister_frame_info__register_frame_infoext2fs_badblocks_list_createext2fs_badblocks_list_freeext2fs_badblocks_list_addext2fs_badblocks_list_testext2fs_badblocks_list_iterate_beginext2fs_badblocks_list_iterateext2fs_badblocks_list_iterate_endext2fs_compare_block_bitmapext2fs_compare_inode_bitmapext2fs_dup_handlemallocstrcpymemcpyext2fs_copy_bitmapext2fs_badblocks_copyext2fs_copy_dblistext2fs_freeinode_io_managerext2fs_inode_io_internsprintfstrcmpext2fs_file_openext2fs_file_closeext2fs_file_lseekext2fs_file_readext2fs_file_writeext2fs_file_flushext2fs_read_inodeext2fs_file_get_fsext2fs_bmapmemsetext2fs_file_get_sizeext2fs_file_set_sizeext2fs_write_inodeext2fs_lookupext2fs_nameiext2fs_namei_followext2fs_follow_linktest_io_managertest_io_backing_managertest_io_cb_read_blktest_io_cb_write_blktest_io_cb_set_blksizetest_io_cb_write_byteerror_messageext2fs_write_bb_FILEfprintfext2fs_resize_generic_bitmapreallocext2fs_resize_inode_bitmapext2fs_resize_block_bitmapext2fs_image_inode_write__errno_locationext2fs_image_inode_readext2fs_flush_icacheext2fs_image_super_writeext2fs_image_super_readext2fs_image_bitmap_writeext2fs_read_inode_bitmapext2fs_read_block_bitmapext2fs_image_bitmap_readinitialize_ext2_error_table_et_listext2fs_new_inodeext2fs_warn_bitmap2ext2fs_new_blockext2fs_alloc_blockext2fs_block_alloc_statsext2fs_get_free_blocksext2fs_inode_alloc_stats2ext2fs_mark_generic_bitmapext2fs_unmark_generic_bitmapext2fs_inode_alloc_statsext2fs_allocate_group_tableext2fs_allocate_tablesext2fs_badblocks_equalext2fs_update_bb_inodeext2fs_block_iterate2timeext2fs_allocate_generic_bitmapext2fs_set_bitmap_paddingext2fs_allocate_inode_bitmapext2fs_write_bitmapsext2fs_allocate_block_bitmapext2fs_fudge_inode_bitmap_endext2fs_fudge_block_bitmap_endext2fs_clear_inode_bitmapext2fs_clear_block_bitmapext2fs_warn_bitmapcom_errext2fs_get_blocksext2fs_block_iterateext2fs_check_descext2fs_bg_has_superext2fs_update_dynamic_revext2fs_flushext2fs_swap_superext2fs_swap_group_descext2fs_closeext2fs_get_num_dirsext2fs_init_dblistext2fs_add_dir_blockext2fs_set_dir_blockext2fs_dblist_iterateqsortext2fs_dblist_countext2fs_dblist_dir_iterateext2fs_process_dir_blockext2fs_read_dir_blockext2fs_write_dir_blockext2fs_dir_iterate2ext2fs_check_directoryext2fs_dir_iterateext2fs_new_dir_blockext2fs_expand_dirext2fs_swap_ext_attrext2fs_read_ext_attrext2fs_write_ext_attropendirclosedir__xstatreaddirext2fs_find_block_deviceext2fs_sync_devicefsyncioctlext2fs_free_block_bitmapext2fs_free_inode_bitmapext2fs_free_dblistext2fs_free_generic_bitmapstrncmpstrncpystrcatext2fs_get_pathnameext2fs_llseek__divdi3ext2fs_get_device_sizeopen64ext2fs_free_icountext2fs_create_icount2ext2fs_create_icountmemmoveext2fs_icount_validateext2fs_icount_fetchext2fs_icount_incrementext2fs_icount_decrementext2fs_icount_storeext2fs_get_icount_sizeext2fs_initializeext2fs_set_bitext2fs_clear_bitext2fs_test_bitext2fs_swab32ext2fs_swab16ext2fs_test_generic_bitmapext2fs_mark_block_bitmapext2fs_unmark_block_bitmapext2fs_test_block_bitmapext2fs_mark_inode_bitmapext2fs_unmark_inode_bitmapext2fs_test_inode_bitmapext2fs_fast_mark_block_bitmapext2fs_fast_unmark_block_bitmapext2fs_fast_test_block_bitmapext2fs_fast_mark_inode_bitmapext2fs_fast_unmark_inode_bitmapext2fs_fast_test_inode_bitmapext2fs_get_block_bitmap_startext2fs_get_inode_bitmap_startext2fs_get_block_bitmap_endext2fs_get_inode_bitmap_endext2fs_test_block_bitmap_rangeext2fs_fast_test_block_bitmap_rangeext2fs_mark_block_bitmap_rangeext2fs_fast_mark_block_bitmap_rangeext2fs_unmark_block_bitmap_rangeext2fs_fast_unmark_block_bitmap_rangeext2fs_get_memext2fs_free_memext2fs_resize_memext2fs_mark_super_dirtyext2fs_mark_changedext2fs_test_changedext2fs_mark_validext2fs_unmark_validext2fs_test_validext2fs_mark_ib_dirtyext2fs_mark_bb_dirtyext2fs_test_ib_dirtyext2fs_test_bb_dirtyext2fs_group_of_blkext2fs_group_of_inoext2fs_open_inode_scanext2fs_read_bb_inodeext2fs_close_inode_scanext2fs_set_inode_callbackext2fs_inode_scan_flagsext2fs_inode_scan_goto_blockgroupext2fs_get_next_inodeext2fs_swap_inodesetmntentgetmntenthasmntoptendmntentfopenfgetsstrchrfeoffcloseext2fs_check_mount_pointext2fs_check_if_mountedext2fs_linklseek64ext2fs_mkdirext2fs_create_journal_superblockext2fs_read_bitmapsext2fs_add_journal_deviceext2fs_add_journal_inode__fxstatext2fs_native_flagext2fs_openext2fs_read_bb_FILE2sscanfext2fs_read_bb_FILEext2fs_write_inode_bitmapext2fs_write_block_bitmapunix_io_managersetrlimitgetrlimitext2fs_unlinkext2fs_inode_has_valid_blocksext2fs_parse_version_string__ctype_bext2fs_get_library_versionlibcom_err.so.2libc.so.6_edata__bss_startlibext2fs.so.2GLIBC_2.1.3GLIBC_2.1GLIBC_2.2GLIBC_2.0si 0ii <ii Fii P77$8(8,8084888<8@88888888889 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|999999999999999999999999999999999::: ::::: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|::::::::::: ;@;D;D>4>8>4<><@>=H>uL>vP>xT>zX>|\>}`>d>h>l>p>t>8<<<@<D< H<$L<%P<'T<(X<*\<+`<-d<.h<4l<6p<8t<:x<=|<><B<C<E<F<H<J<K<L<M<O<P<R<S<T<V<W<Y<Z<^<_<`<a<i<o<p<r<t<v<w<{<~<=== ===== =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=================================>>> >>>> >  > $>(>,>0>US[8[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhUS[Ht[ÉUS[ud8t.0PЋ8u⃻ tP:ǃ]ÍvUS[X[ÉUS[@tLPP]ÐUS[[ÉUS[u u]ÉUS[u]ÐUS[äu u]ÉUS[|u u]ÉUS[Tu us]ÉUS[,u u]ÉUS[u]ÐU0WV}u =+t +>+GEN9u)W ;F u)ȋvu}}t 8+K)9w8u}}uEEU)}҉+E}9uA;Mv1^_ÍvU0WV}u = +t +v> +GEN9u)W ;F u)ȋvu}}t9+L&)9w8u}}uEEU)}҉+E}9uA;Mv1^_Í&UWVS[^E8+t+hEEuEF+}}u"E@ @@$@,@0@H@LUB@t@My уQ.UB uEF+}@Mq PAhNjExuEF+}UrUB BP‹MQ$uEF+}MA APEp$R&MQ,tE,PREuEP0tE0PREu[MQHtEHPRqEu7EPLtELPREuE U1&MQEe[^_É'U WVS[j8ǃ1uF+uV+E PfPwV7G$EG(E G,G0dG4dE01e[^_ÍvUWVS[z}u:+l&d1 v4tFPEPWu)t&t F4G4 t&F4dj`EEEuEF+}}EE+0UB}уQ+UBuEF+}uaMQEp?UrXB BBBe F$PM Qv,v(fE u EU1%t V}t MQEe[^_ÍvU WVS[uu>+t +xVX:+t+`FHNȅ~1Mr$ǃvX FXFtPFEPe[^_ÉUU:+t+BX8+u E B 1+ÍvU WVS[}E ?+t +RwX>+t+:jjG Pv$u"}}EEG jPuv$e[^_U WVS[z}E ?+t +NwX>+t+:jjG Pv$u"}}EEG jPuv$e[^_UVS[E8+t +>pX>+t+&jju v$ujuuv$(e[^ÐUS[ÐE8+t+ @X8+up$5v+]ÍUWVS[>EtUBu +hƉuEuEF+}E(+EFU VeMF PREPEu5UB@P#uEF+}u E015MtPEǀUREe[^_ÍvUE8+u@1ÐU WVS[u>+t+x~%`=`u`u0PjGPF PvW u)G@jw@Ѕu 1e[^_ÐU WVS[^uN1q;tVu߉1e[^_ÉU WVS[u~ u~PjGPF PvW uP} uAt$G@jRw@Ѕt#&wjm 1e[^_U WVS[Zuu>+t +>VǃtPdžEPe[^_U,WVS[}EEE E?+t +WUG9}W&EjWeEuoEURU1uыu);uvuG+E9vVQEPmuu)u;Gs }e}tEUEe[^_ÍvUWVS[EEE EU:+t +E@EUM+&EPEUURU1u׋u);uvu;u%PEPEu=U@VEPW@Uuu)u}a}tUEEe[^_UVEM Uu8+t+4tutG+Ht1^ÉUE8+u@1ÐUS[HU:+t +!vE BB Prru1]Í'UWVS[1EPEPURƃE%f=tUE 1EE~ @+v}tNEp ǃuF+ufUBPWjuPBЉƃt W=EU RuURjuPuu EPƃ0t Wh[^_ÍvU WVS[}u?/uE EGN1Nxez:/t ANxYG+t+VX: +t +mFHNȅ~1TRtBR@ ЉEvXIFXFtP/FWEe[^_ÐU WVS[^E18+t+v&pX> +t +]VtBM QR@ЉǃFt WU R,tWPM QPe[^_ÐU WVS[öE18+t+~pX> +t +lVtBuMQM QR@ЉǃFtWURM Q3tWCPEPU RP3e[^_ÐU WVS[E18+t+~pX> +t +lVtBuMQM QR@ЉǃF tWURM Q3tWPEPU RPe[^_ÐU WVS[VE18+t+~pX> +t +lFtPz tuMQM QPB ЉǃFtWURM Q-tWPEPU RTPe[^_ÐUVS[çE18+t+U@X8 +t +CPtBR@ЉƃtVVP~PMe[^Ít&UWVS[}EPu9u;uuPWjVuu׃u1e[^_ U WVS[Þ}u G+? +t +G 9Ev#O;MvM9v+GWI;O wG9E uEG iW)@EE )p9ut$VwuF+5&G;uv+uVjGEEPEG E G1e[^_ÉU WVS[öuu G+-t&> +u +Vu u> +e[^_U WVS[^uuG+(>+u +Vu u>+e[^_Í'UMU ~vAt 1t&JUWVS[UBPMEu3 ;+0qv%+dEEM;AFMQ$EDEtA(Et&E U9UvUMAPMQMQMQPBЉƃ}}EuugEpWt(MEMUBǃjPM Q밍vF;usUBPP~tރMAPWE PpƒMA9u)u)u>}EUE;P1MQe[^_UWVS[UBPuEu; E;+t&EE$+t&EEM;AEvUB$MDEtr(tot& 9vUBPMQE PƒmMA9lAPMQWMQPBЉEu/})uE EUE;P`MQDEEPbEe[^_ÍvU WVS[âEp!Eu MqjEPY}MqEpMQE PBƒ t)M;Qu@EP Rp$M Qƒu:0MAA 19t%+EPe[^_ÐU WVS[EpFpV;Eu lVMQu Ju 0=9t$+2ExuPЋMAUPRq$1EPe[^_ÉUWVS[uEt(~,uVF,PF@(&~0uVF0PF@ FPRU Rt;t%+t&t&~1҉ω󫃽tTF+tCvVRM Qy9c)u1[^_U WVS[ú}Et.,uW_ƃG,@EGp(,0uWaƃG0@EGp wVǃu Wt&VWu u F0%9t %+t&VWEP21t We[^_ÍUS[hlu$h\l [ÉU,WVS[~UM 1:+t +}ur,uu'+RUt A1v(UB(HzLt ;JTr t& w u~LtNT΋E@EURUEUEE+EUtFE;0v UzLtrT9u;urE;p vVjUR1+EUu E01I+e[^_ÍvU WVUu E:+t+fuB0u(+TE1Kt&Jt;qrqx}@EM+E}tBE;PrQ9u߸H+^_ÉUWVS[}Eu*Ep3E1uF+}UrjWfEx0uPQƃuXEPju URƃu=UBPWjuPBЉƃujuEPUE1}t URe[^_UWVEU с8+t +}up0uu(+@EuH}uU}uEEE&UD u;FvEH1;u}$UzʋE+PuBF;u|U 1&A;MuH+^_ÐU WVS[u}U JЋN1q(E~E Pv,!M Qv,F$Uf)|}tF$f|F)xNe[^_ÉUS[Àjuu u]U WVS[V}M w+V1v ƃ}~Qw0z Qw0,G$Uf)T0 GU)P O&e[^_É'UWVS[UBP M ʉMHMUU@9rHEUB EEM9vEE}u UR0UMQ$E E|uaEPEPq(URMQEP m1uU;B(}VMQ}GFE;x(|MQ$EMD EPPt)H(MU M+M1UU9UvMMEEUB$M<uquVEPjURMQEP =H+uRURjMQEPUR uMQEP$EM UB$M|ukuVEPjURMQEPi =H+uRURjMQEPURB u!uMQ+t +8j &1uF+u+rBE 1e[^ÍvUVMu 9+uA8+uQ;P|1t&@ A^ÐUS[ Et8+u@P]ÐUWVMU =+t+-:+u%A;Buq z u1^_Ð&UWVS[{E8+t +vUz0u (+EEEE j(‰U1uF+EPjREpyEuF+CUrjPE}W6PjjjEPƃ0Eu\} tcWU RƃWX7PjjjEPƃ u/Et `WjURƃusjphlujflEHʅ} EЉ|dWjURdƃu$EuEH[^_ÍvU WVS[F} u u1vMQ;Bsf;Bra}}KF 9F|5 F PvuF FF+0t&FNVFj7EP_e[^_U WVS[Úu }|.EP60u F&V;V}HFUFEH0Ћy9r;A vPjQ|1t&)AuEPjjURuUBPvjuPBЃt FjuEP_UE e[^_Ív'U WVS[Îj<ƃEuEF+}tE +FEFE F EFF=+}tA}уQFuEF+}ueURPFFV)‰xW_FEuEF+}t#vFFV3E)}tWURP WjP\E01e[^_ÐUS[Lujuuu u]ÍvUVS[uEPvvvv vVu#UUFBUFBUE 1e[^UWV}w F+O;wwGFA;wv^_ÐUVS[Ëu>+t +TDFtEp(URM1‹BR RPVM1A E tMu@ u[UtS@tv}~}ĉOuMB@qju6r@ЋUBtMMAu.uu#q(EPU RjjMQu6F EEe[^_ÉU,WVS[&EEUHMBu%r(uVU RjjMQPuFЉE EtUtEƉUrz uB;Hs;HsE@6+MB tMArjq [B@uv jQr@ЉFExt MuU@t r }~}vĉOuMq EAt31EG;}}~EPURM1V EtY1EEEEG;}}?>uEUMAQ ፶EPURM1V Et Eu@ u_UtW@t"v }~}t&ĉOuMB@q ju6r@ЋUBtMMAu.uu#q(EPU RjjMQu6F EEe[^_ÉU,WVS[æEEUHMBu%r(uVU RjjMQPuFЉE EtUtEEMAQ uB;Hs;HsE@7+MB tMArjq$B@uv$jQr@ЉFExt MvU@t r$}~}vĉOuMq$EAt<1EG;}EPURM1V Et[t&1EEEEG;}}9>uEUMAQ EPURM1V Et Eu@ uZUtR@tv$}~}ĉOuMB@q$ju6r@ЋUBtMMAu.uu#q(EPU RjjMQu6F EEe[^_ÐU WVS[#DžDžE8+t+&UtXDPM QEP豻0hDžD%f=@t}tR+=t&uVU RMQ̷EP EM@E,Dž Dž$}t U4*RP蜹‰41uF+MA48‰+t +7FtV!uF +t +bF9F r+dF@Pvu FF+-FF @VF UPU UPF1e[^ÐUWV}? +t +DEDG101W 9s"OU1ҋu 94u u9tt̃ @;ErN+^_ÉU WVS[F}? +t +\u8^Pj w w6G1;w s.EEPEGPwU ҃u E F;w r1e[^_ÐUVMu AV9u9uFI)t&)^ÍvUE@ Í'U,WVS[n}? +t +EE E}t EE(t&Gp負E1uF+uMEEEEEEPP_PWƃ}uupEuEe[^_ÉUWVS[âu} MQjjGEEEURPWRVe[^_Ít&UWVS[NuFPMQju PBЉDžuzFЉUUUvuS}tĉBfBBfBJ΃vt #+B9~#+ʋE9re[^_ÍvU WVS[Ö1E@@pǃ1uF+}UrMQW舡Ep9sO&Afvt#+NAĉBfBBfB9rUUMAPMQju PBЉƃt W^e[^_Ít&UWVM }9}(UrBfvu B9~1 9%^_ÍvU,WVS[V}?+t +E PW象ƃE EEE}tEEw菝EuF+uTEEEEEEP jjE PWƃ }uuHEuEe[^_ÉUS[|E puuuuЋ]ÍvUWVS[F}uMEUBMRxbPVWE PEPe[^_U,WVS[UME E1EEEy EtEUrE 0URUBt>EEP9UE@EN99Ffvu F9~UB#+>u E@tCEpEPRWV9}EPU2B Ѓ }EtERV9}u:EE@t7F $9t*4:v9}VWUrt׋EP9}t!UrE 0URUBu }u1e[^_ÉUWVS[.u}E EU t p1EPjpEPěuCv?EPjjEPu{EuuUR,W&Ep"‰U1uF+u/EpjRZUBPujuPBЃ t UBDuԝEEU jPEP賙UB:ue[^_ÍvUWVS[ۙu>+t +vFu +~0u (+E PVEEEEPdPjjE PV藗 EuX}u++KtWE PV u0Fx} EEWE PV˛u1X[^_Ív'UWVS[ΘE} u@0U9t PVWĉFĉGFĉGF EW UFE}1ҹ}ċ}IyUM;UsN~ tHBfABĉABĉA$$;Us:ue[^_ÉU WVS[җ}uGPVju PBЃuGt VVW试1e[^_ÐU WVS[Â1E@@t7pǃ1uF+uMURWEPOuUBPVju PBЉƃt W谚uEHe[^_Ít&'U WVS[ޖjaƃtC}Q@u V>URP_U F2e[^_ÐU WVS[jE8tw7W uEe[^_ÉUlWVS[}IURu%M􋅤P誘 4􋕤Rr 򮋅)=z .uz fz .VURCPV˙PVj薕%=@uEPV,%=`uNU 9uCE9u8QjǃVW蓙U:􋅤P:ƒ􋕤Rn1[^_ÐUWVS[nEEEuVIPSVRPC VYP0}uuEEEut+VtBR@ ЃF tP茖F FtPrFFTtPXFTF$tP>F$F0t PDF,t P聒FHt P输FHFLt P贕t PW輕e[^_U WVS[utK> +uCFtPxFFtP^FWKe[^_ÍvUS[ÐEt8 +u +Po]ÉUS[XEt8+u +P7]ÉU WVS[uFPVuBtP虔FtP耔FGWfe[^_ÉU WVS[êu>+u*F tP*F G We[^_U WVS[VutK> +uCFtPғFFFt 9pLu@LW蟓e[^_ÍvUS[MU A9r;Q vRjQ1 )‹A҉Ћ]ÉUS[ØMU A9r;Q vRjQǎ1v)‹A҉Ћ] U WVS[>u}~u!j^PFP芐uG9uXF@P芎‰W1uF+t G +FPFPRVGt&1e[^_ÉU,WVS[Ò} ;}uHj U1uF+c}uaRP1t}}5j軍‹M1uF+e1EEEEEEPpPURjWMQGƃ .Et EPEPEHPWuURƃ }uEM1UtF}щMыU PɌǃu9F+}эAP蕌ǃuF+ugExt PW͎aPW躎Et iPW蛎U:u8E1EtPEe[^_ÍvU WVS[VE8+t+\Ep‹ǃ1uF+u7E9E uEuWj EPE PEPQƃ W臏e[^_Í'UVS[ÿujE URPV蹏|jEPVS~1e[^ÍvU1EP1we[^_Í&UEU UEU UUE UEÐUE%ÐUS[`wUE J9r;B vPjRv1r)Pt]US[wu uWy]ÉUS[vu us]ÉUS[vu uz]ÉUS[àvu ux]ÉUS[xvu uws]ÉUS[Pvu uy]ÉUS[(vEp@U )‰Pu]ÍvUS[uEp@U )‰Px]ÍvUS[uEp@U )‰PDs]ÍvUS[ÌuEp@U )‰P@u]ÍvUS[XuEp@U )‰Pw]ÍvUS[$uEp@U )‰Pr]ÍvUE@ÐUE@ÐUE@ ÐUE@ ÐU WVS[þt}E ;Gr UD;G vwM Qh/+0y1-1;u}!t&E PWquuF;u|e[^_ÍvU WVS[Bt}19}+E PEPut1 vF9|۸e[^_ÉU WVS[s}E ;Gr UD;G vwM Qh-+\x'1;u} vwE +GPlsF;u|e[^_ÍvU WVS[vs}1;u}wE +GP%sF;u|e[^_U WVS[2s}E ;Gr UD;G vwM Qh.+w&1;u}wE +GPuF;u|e[^_U WVS[r}1;u}"t&wE +GPLuF;u|e[^_ÍvUVS[wru uqt1F+e[^UVS[?ru6u1e[^UVS[ruu 6st1F+e[^UEHUEHUE@ÉUEHUE`UE@ÉUEHUEH"UE@ÉUE@ ÉUVEpVE )1v ^UEU JH1q(Ð&UVut11;P }*1ɍ@B;P |1^ÐU WVS[pEt1#j6pNjUEuEF+}EEpouEF+}U@@@ @F F PoFuEF+}uMQ>o1=E6WsU=sMǁEe[^_ÐU WVS[roE8+t +UzHuHz4B4ЃHPRmƃt MAHtP|puFHEx4j`nE1uF+t EvU׉E+UPBxLtPXMQ(A0Au~Oy} t E A t&UB MQJ$uFDF B@(FB(FF }GPmF$1uF+E@8@<@@tP@Ur(mMA4uF+t%}w$vqG$Wcq!UB@Ht xtJDEM1e[^_ÉUVS[Ãmut;>+u3v$qF$v4pF4Vpe[^ÍvUUt:+u E B8EB+t+OF;8v)+AF4tURWVЃt&EPWVbu1ҍMuB~1h[^_ÐUWVS[au} >+t +XvF;8v )+GF8tWVЃ=A+u-EPWVjbuE%f=@u1 t&J+h[^_U|WVS[NaUEEPRaEuI`EEuVU Rj@au EȋỦEU} }&URD^ƃtD6E P^t+t҃UR6j`uE;EuU;UuuwE EaEPWj`AU9U5E9E)U}EPWUR/d&EPvj?`}_EE EtU9UE9EUPVGatE}tURvEPcvuHU jBVRb}f^8uE Pp]V]EUR~aEx[^_UlWVS[^DžDžDžVEPj^uPPbǃu1DžWhV^vj V[tj Vp[tURV\t t9PVj"^u ;u;KW2[uWhV,^QW_[^_ÍvU WVS[R]}uVWE PEP#P tVWE PEP0P1e[^_U WVS[\} uEPuVEPWEPc!t& V:PEP`1e[^_US[Ì\jju u\]Ðt&UWVS[^\}uEF $EUU G‹M E9}:uB;EBfGE?tDGH wU 9|5fOUU GfB)frPvG;E}E?FFfGv6GP_F@`tF f GFe[^_ÍvU WS[W[U}:+t+{Bu +n}tIM&EEEEEEBEEPPjju RU_u 1}u&+e[_Í'U WVS[ÞZuE UMu=wQPV\Xt&ttY4QRPV[Ɖ׃uuaY8&u te[^_Ít&U WVS[Y}uGV9u*RGP6K[uVF 1e[^_ÉU$S[äYU:+t+FEEEEEEEEPPuju R]u 1}uL+]Ít&UWVS[+YEDžU:+t +u/PjhAM Q}W\ MPjjEPY(PU RMQY} ;t$uVWEPAYU׋ ֍1 }G\Ѐ@ffDžfDžG} (fDžj]X UBRX  PMQ@Z}Pj}эAPURM Q}WY uDžO+L+u}jEPU RMQY uT} ;tfEVWEPYu*jUR6VjjMQZ tP ZDž[^_ÉU WVS[>V} wU+EpUƃ1uF+EpjVY;9Et F vFEHffF ff~F@FFEPBhF0BlF4BpF8BtFM}E?+t +wLƃ1uF+upwjVPGfF} tMG@`tEE E fFF.FfF V fBEF E fBB.B .E01e[^_Ð&U,WVS[nLE8+t+hKEEuEF+}}E"u+} ~F\Pu VEPUBЉEuWMAH\}уQ?KUB uEF+}MQPTPhKuFuEF+}} t{hLJEHXuEF+}UBPQhjPBЉEMAX8+t +wEE}t;}u EG+?uFP}WPBЋE@EFTZUBPhPBEEhIMATEuEF+}uFPvh}WPBЉE~TtEpuNSċVf9A8t@t@}WQKUBfx8St E+4xLv E+"M uG@`u2}t@dt ED+u u}G@`t EC+EpNMAN}G~(F~LtFXD:1 D:1UB(}tM;Jt E"+VuFPvPBЋNA`tF}711y u E<+AQ)‰Ѝt1Ƌ}wIT71UJ JQG‹MQ$EuEF+}}u uF@@EEU1};x sqEv@@URjMQ}w@ЉEuREFuG@t%}UB9E}ƃW ENuMIMuE;p r}u>1EPFEe[^_ÉUVS[OGu }|'EPE ;Br;BsP6cGFu1e[^UWVS[F}u ?+t +>uTEPjWGuqUwO} 1APVEu3xxFVPjjjWDuFX[^_Ðt&UWVS[+F}t?+t +E8u|j PDtj|PKPViI~G|t(G;Pr;Pr}t(EPVRWEЃQE0Eu5E PCu E PhuVFh1h[^_ÍvUS[8EEt u uЋ]ÉUS[ E􍃼Puuu uH]É'UWVS[DuF,x>+t +Fu +F@(EvD‰U1uF+t+vhR/HEE;FseEURWEPOFF$ULt$FPUURjQPUBЃz}E EE;FrF $FURRG1e[^_UWVS[ÖCuF0@E>+t+?t&Fu +*}F@ EvB‰׃1uF+tt&+vhRFEE;FEURMQWEFH9Eu7FPH)щʉЋN1q tF9}BF9|F$U tFPWjQPBЃDMME EE;FkF $߉FWE1e[^_ÉUWVS[BEEEPB }EB(}EU:+t +DMAjju]ÐUS[è>jjuj]ÐUS[À>U:+t+1J,B0tt1%P%PR]ÐUVS[#>u>+t+7~0tF tV>u~,tFt V;u1e[^UE։P։PP։PP ։P P։PP։PP։PP։PP ։P P$։P$P(։P(P,։P,P0։P0P4fP4P6fP6P8fP8P:fP:PfP>P@։P@PD։PDPH։PHPL։PLPPfPPPRfPRPT։PTPXfPXPZfPZP\։P\P`։P`Pd։Pd։։։։ÐUUĉBĉBBĉBB fB BfBBfBÐU0WV} uU1Ʌt%f=fu%f=uFfGFĉGFĉGF ĉG FĉGFĉGFfGFfGFĉGF ĉG t~tDEF(EW(UEME ͋UE UE}vA9t=EW(UN(MEEUUMUE}vߋFdĉGdFhĉGhFlĉGlFpĉGpE@@HtMrF$ĉG$FtGtFuGuFvfGvFxfGxFzfGztt&F$ĉG$FtGtFuGuFvfGvFxfGxFzfGz7&F$ĉG$FtGtFuGuFvfGvFxĉGxF|ĉG|^_ U,WVS[>9E}}EE]UJ UB UЉUEEEMMEeƉ׋MMϋEEjWVU r<9u9t7tEE+=EPURE pS=EU9t}E$+t&1GE+EPjEEPD<UBt VURURURURURURЉƉe[^_ÐU,WVS[ 8E}u E@ E(}}UU]EH UB MЉUEEEMMEeƉ׋MMϋEEjWVU r;9u9t6u:E+3&MQEPU rJ5EM9u1-%+MQtPEPMQEPMQEPMQҍe[^_U WVS[6E @ 1pFFf Ep P61҅uF+t G~1e[^_ÐU WVS[Â6E @ pFFf tP9Oyʍe[^_ÍvU WVS[6111ɋu F uE9Ft(tB9F}A~փ}u1X&U B HJ +t+&~X?+t +FPVЅ~1vjWVEw0 } 1EWVvX5FXFtP5FEP5Ee[^_ÉU WVS[1}?+t+NwX>+t+;E 9G t1jVW6u E G VWVWu1e[^_ÍvU WVS[f1uE8+t +@URXU:+t +%}};jEPURVEPU REPUR}jE PUREPt)Ur 0W2ME Ex 뺍&F;u}jE PUREPRtރWVU REPUR uOeMjE P@E UREP tUr W0^2Ex Nu 1e[^_ÍvUWVS[/uEE8+t +URXU:+t +}v>jEPUR$EVEPU REPURUEPUtVEPU REPUR)E }~}&jE PUREPƃu$WjU REPUR t*E%Ep W61UF $ЈF ME Uz }Ee[^_ÍvU WVS[Ú.E}8+t +gpX>+t+SjVPu@ju v{0} o- Wuv,,9u1 t&%+e[^_ÍvU WVS[-E8+t+.pX>+ujVP^ǃvU/+e[^_ÍvU WVS[Þ-}utG;FuPGPR.u Ft 9t 1t&Fe[^_ÉU WS[7-U}:+t+vBu +i}tIM&EEEEEEPTPjju R:1u 1}u&+e[_ÉUU%f=@tf=t f=t1%f=uztÐUVS[R,1U:t$t& @DHttAB:u[^ÍvUS[,UM tt.]Ít&UPWVEEU EUUMUM}} EE؉ƋMمtIωu}}}$UE؉EMمtIMEUEU}UUċMMuuC9vȉE}u 1ljU֋EEt&9uv EUău;uw9}rEivE )U܋Eĉ}MmM ȉEĉu؋Mm؉EEMm ueUuĉEĉ9wu;uvM1ɋEĉEЉMԋUЋMԃ}t؉EȉڅtJŰUȋM̉Љ^_ÉUVS[*t Ѓ>u[^ÐUS[)[ÍUS[).[Inode I/O Manager%u:%dTest I/O ManagerOKTest_io: set_blksize(%d) returned %s Test_io: read_blk(%lu, %d) returned %s Test_io: write_blk(%lu, %d) returned %s Test_io: write_byte(%lu, %d) returned %s Test_io: flush() returned %s %d Journal not foundError loading external journalUnsupported journal versionJournal must be at least 1024 blocksJournal superblock not foundSupplied journal device not a block deviceExt2 file too bigUser cancel requestedUnimplemented ext2 library functionExt2 directory already existsExt2 directory block not foundFile open read-onlyFile not found by ext2_lookupToo many references in tableExt2 inode is not a directoryCould not allocate inode in ext2 filesystemCould not allocate block in ext2 filesystemInvalid argument passed to ext2 libraryMemory allocation failedIO Channel failed to seek on read or writeFilesystem has unsupported read-only feature(s)Filesystem has unsupported feature(s)The inode is from a bad block in the inode tableThe callback function will not handle this caseToo many symbolic links encountered.Illegal generic bit number passed to ext2fs_test_generic_bitmapIllegal generic bit number passed to ext2fs_unmark_generic_bitmapIllegal generic bit number passed to ext2fs_mark_generic_bitmapThe ext2 superblock is corruptA block group is missing an inode tableIllegal or malformed device nameInode bitmaps are not the sameBlock bitmaps are not the sameIllegal triply indirect block foundIllegal doubly indirect block foundIllegal indirect block foundAttempt to fudge end of inode bitmap past the real endAttempt to fudge end of block bitmap past the real endIllegal inode number passed to ext2fs_test_inode_bitmapIllegal inode number passed to ext2fs_unmark_inode_bitmapIllegal inode number passed to ext2fs_mark_inode_bitmapIllegal block number passed to ext2fs_test_block_bitmapIllegal block number passed to ext2fs_unmark_block_bitmapIllegal block number passed to ext2fs_mark_block_bitmapNot enough space to build proposed filesystemInternal error in ext2fs_expand_dirIllegal block numberIllegal inode numberBlock bitmap not loadedInode bitmap not loadedNo free space in the directoryAttempt to write block from filesystem resulted in short writeAttempt to read block from filesystem resulted in short readEXT2 directory corruptedFilesystem has unexpected block sizeCan't read next inodeCan't read an inode tableCan't write an inode tableCan't read an block bitmapCan't write an block bitmapCan't read an inode bitmapCan't write an inode bitmapCorrupt group descriptor: bad block for inode tableCorrupt group descriptor: bad block for inode bitmapCorrupt group descriptor: bad block for block bitmapCan't write group descriptorsCan't read group descriptorsAttempt to write to filesystem opened read-onlyFilesystem revision too highBad magic number in super-blockWrong magic number --- RESERVED_9Wrong magic number for inode io_channel structureWrong magic number for Ext2 Image HeaderWrong magic number for ext2 file structureWrong magic number for Powerquest io_channel structureWrong magic number for icount structureWrong magic number for directory block list structureWrong magic number for test io_channel structureWrong magic number for generic_bitmap structureWrong magic number for inode_bitmap structureWrong magic number for block_bitmap structureWrong magic number for io_manager structureWrong magic number for unix io_channel structureWrong magic number for io_channel structureWrong magic number for inode_scan structureWrong magic number for badblocks_iterate structureWrong magic number for badblocks_list structureWrong magic number for ext2_filsys structureEXT2FS Library version 1.27#%u for %s#%u%s/%s/devices/devfs/dev../....???bad icount%s: count > size %s: list[%d].ino=%u, list[%d].ino=%u block bitmap for %sinode bitmap for %sr/ro/.ismount-test-file/proc/swaps/proc/mounts/etc/mtab/.journal%ublock bitmap for %sinode bitmap for %sUnix I/O Manager1.278-Mar-20027(<+G@II JJK$K 8+@VXXhYZx[Z8-%%$$@$$##@##""@""!!@!!  p @  @"`=nYD ` ` @ ` @@` D `?  9+Y+&8\ 8  0   :&&! 8 P Z ,<40PoP0oo.ozL;&969F9V9f9v999999999::&:6:F:V:f:v:::::::::;;&;6;F;V;f;v;;;;;;;;;<<&<6<F<V<f<v<<<<<<<<<==&=6=F=V=f=v=========>>&>6>F>V>f>v>>>>>>>>>??&?6?F?V?f?v?????????@@&@6@F@V@f@v@@@@@@@@@A7.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss   Z!o..4.oP0P0P= 00PF 44 O88%J99UAA@[PPaC i7'h oH;H+yL;L+<,$<$,,<,,Lx>x.x.ELF 44 (,,|,,%@!8?=1*+4<,>7 0:)&26;9$'"./(-5%#3004$       , ,,---$.t@y hc   /,b'"7Z  }  *d/ J#"?  1;  n x # l4 0V  $.L3 u5 ;;{"=$. -D.=Was`*:= _DYNAMIC_GLOBAL_OFFSET_TABLE___gmon_start___init_fini__cxa_finalize__deregister_frame_info__register_frame_infouuid_clearuuid_compareuuid_unpackuuid_copygettimeofdayopengetpidgetuidsrandomread__errno_locationsocketioctlclosestrncpyuuid_generate_timeuuid_packuuid_generate_randomuuid_generateuuid_is_nulluuid_parse__ctype_b__strtoul_internaluuid_unparsesprintf__udivdi3__umoddi3uuid_timeuuid_typeuuid_variantlibc.so.6_edata__bss_start_endlibuuid.so.1GLIBC_2.1.3GLIBC_2.0si ii ,,. ..$.2.8 .?------- -!-"-$-(-+-/-1-2-3-7-9-:-;.<.=.>US[ü#g[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhUS["|t[ÉUS[! udtt.l0PЋ8u⃻pt$Pnǃ ]ÍvUS[P![ÉUS[8!htP$P]ÐUS[![ÉUE@@@ ÐU,WVS[ö u EPuEPVMU9t9sxMUf9tf9saZt&MUf9tf9s?8MUf9tf9s!t&u}1t e[^_ÉUVMU BANy^Ít&UWVS[}ujjWj|P uhP13u3wVjW~u3u~ Ne[^_ÉUWVS[u#EE|M )u E} ~8E PWEPƃ}stԃ tυE} uƒ} ~u |GNue[^_ÉU<WVS[kjjj} 1DžFVhRq}FQMBfAPst&19}pujPV Vh'Q |2U}uBuzuzu zuzt }\ ;|P1[^_ÉUWVS[ujV1u>u5jPfEUU9|uDV9}@f#v9u e@ t&ǃEUFBƉU1ҋME 0Ef1e[^_ÍvU VS[ u5􍳚V8jVǃ uEPVEPfMEfEEfEEfEuVde[^ÐU,WVS[.juV}WVE?̀fEE@fE EPWe[^_ÐUVS[u| V V$e[^É'U1ɋUBt1 A~UMU BBBABBABBAB BA B AfBÉU,WVS[}t 1ut t tu>-t$u>txDBtGF$~jjjUR#EE jjjP fEEjjjPfEEjjjPfEuE1EEUUEEEFEFjjjURUG~փu EP 1e[^_Í'UVMu Q Q Q ЉQA fFQA fFQA fFA F AfF^ÉU VS[Wu EPuNEPEPEPEPEPEPERf%PEPEPuPVe[^ÍvU,WVS[EPuUE ‹u11҉1 jhWVeEUEEjhWV8jj RP:E} tEUM QEe[^_U$S[,EPu&Ef %]U$S[EPuEf|1&@u t& t  t&]ÍU0WVEU }MMEUu?9v E}u 1NjEUUEEvU9Uv Euu#M9Mw 9}rލEl&E )uE}MmU ЉEEEMmUM ЉEeUuE9wu;uvM1ɋuuMEU^_ÍU0WVEEUUMMEEU U܅uN9Uvu%}u 1uEE܋UuU܋EuU} u1M1yE9Evulju}UUu;M9Mw E9Ert&M܋U+UMM܉U}u}E U)UeEM EeU܋MMe܋EM E܋MeEuUeE;Uw uE9Ev M+MUM؃}t+M܋E+EщM܉ʋMM ֋}E0xEU^_ÍvUVS[t Ѓ>u[^ÐUS[[ÍUS[è[/dev/urandom/dev/random@%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x~-M,- 00  -$ @ooo4o, * : J Z j z  * : J Z j z ,.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss  0000!o44.o0= @F $ $  O %J  U `[a   i, o,y,---$.$ $ELF 4)4 (2'2'@'@7@7`'77CCB :45;/7=29@?A>'(*-0!<)+,$#"%.6831&T   \    P% l% @7 7788809@9r z 1` Kc ( 7\'";zo `2u\ {5PZ D#" >  y q *09/P% ;;Ts   5{" @ 09 8;r(Ehl | U`7t * _DYNAMIC_GLOBAL_OFFSET_TABLE___gmon_start___fini__cxa_finalize__deregister_frame_info__register_frame_infocap_initmalloc__errno_locationmemset_libcap_strdupstrlenstrcpycap_dupmemcpycap_freecap_get_proccapgetcap_set_proccapsetcapgetpcapsetpcap_sizecap_copy_extcap_copy_intmemcmpcap_get_flagcap_set_flagcap_clear_cap_namestolower__ctype_bstrtoulcap_from_textcap_to_textsprintflibc.so.6_edata__bss_start_endlibcap.so.1GLIBC_2.1.3GLIBC_2.1GLIBC_2.0si ii ii @7D7`7d7h7l7p7t7x7|7777777777777777777777999& 93$9<(9?,9A8888 8"8$8&8*8,8/8083888:9;9=9> 9@9BUS[T-\'[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThUS[+pt[ÉUS[ð+uddt.\0PЋ8u⃻`t$P~ǃ]ÍvUS[(+[ÉUS[+XtP$P]ÐUS[*[ÉUS[*jE}u 17EАEEjjEP"E0U]ÉUS[D*}u:1hEP]PR/E}u 1*UЕEEPEPU]ÍvUS[è)}tE8Аu10KE}u1jEPEPU]ÍvUS[4)}t?E8Аu1EjjEPEPE1t}tXE8ЕuJEPPUEEPjEP_EP0E1]ÍvUS[`(,E}t+EPEPtEPU]ÉUS[(}tE8Аu5t&EPEPEE0Ut&]ÍvUS[È'} tE 8Аun>E UPE PE PEE 0E @U]ÉUS['} tE 8АuEt&E UPE PE PEE 0E @U]Ít&'UÉU VS[[&EEE E} t#E 8Аu}v}u)&&jPEP]E@E}~E}v t&UЋUEEMʉMUEEUщUMΉu EEUщUMΉu EEMʉMUERE0e[^ÐU4S[$EEEE}t"jPEP u1/gE}u1EPUE}~ t&EE}t t&EE;EtEMʉMUEE;Et#EMʉM EEE;Et#EMʉM EEE;Et#EMʉM EEUЋUEE,Et&U]Ít&UWVS[N#}}t}E8Аuo} |i} c}w]EPEЉEEUu  Mu E}M#<ʉ1e[^_U,WVS[Î"}gE8АU}K}A} 7}t }'EE;E| EE<|EE<vEEUE PEЉE}uNEMMM}4u}Euu܋u܋}M 494TEM}}} M}Euu܋}׉}}Mu#<<E1t&e[^_US[ }t/E8Аu!j jEPr1t&]Ðt&U0WVEM}u[t&EUэMMu4u} }MMuu}}Mu<Mu <<뚍e^_ÍvU0WVEM}uet&EUэMMu4u} }MMuu}}Mu<׉}}Mu#<<뒉e^_ÐUS[xt&E 8t ERmU  9t EE ȋE 8u'Ehfu E8_t 1 t&U]US[EUEh%ftAjEPEPLE}v EUUEM}uet&lUэ<t?lUэPEPE}tEUU뗍&]UE8+tE8-t G&}uyEUЊUEEh%fuDvE8t(Eh% fu &)u[^ÐUS[|[ÍUS[`[ÐQcap_leasecap_mknodcap_sys_tty_configcap_sys_timecap_sys_resourcecap_sys_nicecap_sys_bootcap_sys_admincap_sys_pacctcap_sys_ptracecap_sys_chrootcap_sys_rawiocap_sys_modulecap_ipc_ownercap_ipc_lockcap_net_rawcap_net_admincap_net_broadcastcap_net_bind_servicecap_linux_immutablecap_setpcapcap_setuidcap_setgidcap_killcap_fsetidcap_fownercap_dac_read_searchcap_dac_overridecap_chownallpie=%s%s%s%s,%d,+%s%s%s-%s%s%s@78&&&&&&&&&&n&\&N&B&5&'&& &%%%%%%%%%{%q% \ P%  8  0oT ooo 7  * : J Z j z @7.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.sbss.bss   0!o.oT T @=  0F   O\ \ %J @U [P%P%al%l%i@7@' o7'y7'8(8(8(t09@)@9@)` @)ELF4\34 ( * *000xx<0<0<0CV6',0NPDLRSI5C.QK"9%H@<2O#BEFGU(=)TJ/?:!$13&+-*;8>M4 A7`v $     0 <0 0 24. *| A K4Wtl x 4 4(0 4 p 1 5 5 ." 5i L`l h5t55d 56@"  0   654 . F6Z0" bU yP> A $6` (6&  l4 ,6b@ @  06-dT < 0 J0 Z<6e v@6L6P6N p t6 $" m  __libc_internal_tsd_set_dl_debug_printf_dl_check_map_versions__xstat64_dl_nloaded_dl_lookup_versioned_symbol_skip__pthread_mutex_lock_dl_profile_output__libc_stack_end_dl_debug_fd_dl_initial_searchlist_dl_sysdep_start__fxstat64_dl_init_dl_platformlen_dl_debug_mask__pthread_mutex_initmalloc_dl_lookup_symbol_skip_dl_lookup_versioned_symbol_dl_profile_dl_global_scope_alloc__libc_enable_secure_dl_lookup_symbol_dl_global_scope__libc_internal_tsd_getcalloc__pthread_mutex_unlock_dl_lazy_dl_debug_state_dl_argv_dl_dst_substitute__pthread_mutex_destroy_dl_main_searchlistrealloc_dl_check_all_versions_dl_debug_initialize_dl_start_profile_dl_origin_path_dl_clktck_dl_relocate_object_dl_dst_count_dl_starting_up_dl_unload_cache_dl_out_of_memory_dl_mcount_dl_init_all_dirs_dl_map_object_dl_load_lock_dl_fpu_control_dl_loaded_dl_signal_error_dl_profile_map_dl_all_dirs_r_debug_dl_catch_error_dl_pagesizefree_dl_map_object_depsld-linux.so.2GLIBC_2.0GLIBC_2.1GLIBC_2.1.1GLIBC_2.2GLIBC_2.2.32ii ii $qi $ii $si  h1p11111111111111111122 22$20282@2D2H2T2X2d2h2l2p2l1t1x1|11111"1$1%1*1,1.1/1112131416282?2A2D 2F(2G,2H42J<2KL2LP2N\2O`2Pt2S00111! 1%1&1)1-10 11$13(15,1601941:81;<1>@1@D1BH1CL1EP1IT1MX1Q\1R`1Td1U hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0$ÍTF[ Z$)R`DL$P+vUWVS[ÿ1p0+|@ DX@4vX`I9trt&! Zt&o)Ѓw !p)Љ >ڍBw 't$Pj>9PHP 9uF txFtxFtxVDt(FLxt$PjR9PtP踷zFPt"xt$PjZ9PP茷F\txtxFxt!PtF@tFxFXtFxF`t@E~ttF<DžPDžDt"@@@DDžHtKPD@9t!Lx@PDžTxHDDž848 <00X,@( 1ɅtHʋ09v΋8@$9sA,zt"PhPPv,89r4;0V,>(҉1fyt 4XtQvPhRPPK;0r;0s~,>V(҉1fyt 4XtQv"PhRPPôv;0r$8t jye[^ÉU WVS[U B,xu>3p2t&R PEPztӋFt1e[^_ÉUWVS[w} EEEP0U9EB9x}䉽`X}؉hpd(8mUvEHM΋}1t Lu1ELu@ u*ELt&uI1t $u(:~#MALVLEpXuI$8~>MA$L$8$:tPjDj设r }uTEEUuEPx Et;;4t P}j4t&jjj11`MxPMj1ɍ_` x8uPj1j蛽UfME䉅`XM؉hpd(`ǀ@ǀ<u0\9H+፶L7d`}+~8v`FB`Fxxu!j/7 ƒt BGE8`F#F9<v<FF9@s@ E\9`@u ǀ@zu:JtB&PhwPPa}`EHV8ƃ9trt&! Zt&o)Ѓw !p)Љ >ڍBw 't$Pj>9PHPʬ9uF txFtxFtxVDt(FLxt$PjR9PtPxzFPt"xt$PjZ9PPLF\txtxFxt!PtF@tFxFXtFxF`t @U~ttF<`x(t;W}`Pujt&xtZ@,@EЍ8t%t&8uup׹ t8u߃ 8t Rj/uEP莹}u ezuBB$ `P BEEװэA$)ĉQRP5E}utBtz< t<:uBtl>t֋8tj/V謭ut&`jjj‹H{Es1뎹`Xǃ{}u+E) Nt!B: utVj#uƒuҋET t8 t3 t.:t)48N9v$F< t < t< t<:u9v F1D9tt}%TUdTQdP…t=:t܃`jjjh‹HuE뤅tm)U)‰PV֭B$)ĉRVPIƒ`jjj‹HuEăuW}tN}č$)ĉeȋ@ 1UȉG@ u;}tPh$P*P+`>}%PMċUȉ t5&O`uҋQA B Q ȅt@B`9FtG9uDA}uG;s D1@ A QA 9B t%PhZPTPJ Q t*A9BtPh^PPϦJE‰уM؃ƒhWhp(u}G`xPj@Mԉl@}̍TPt>1U܀:t:=t@M܀<t<=uu܀<0=+D琍&xK,  E܍Xx E܍gPSE܍ uxǃ%E܍uǃE܍x}܃8E܍#ux (E܍,x ǃ:iu܍5 J&@E܍? %j !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]jj P‹88E܍J $}܃ 8vE܍V uǃ E܍c uǃ }xt&u܍p Z,I84E܍}x}܃8u܍Et&E܍ EƃEE) U?tGEw}w;jjEPVCƒwE9t}wt<.tE}t?x}82E܍u}܀5uEE܅EU8tWVjVp xujWЬ􍃹Pޕ}}эQU؍X%?)D 趧u؍D4 }ƉN)}9хuߍFF.+E؃URMQPThhAPue[^_ÉUS[t0Pf|0PO]Í&'U WVS[}WEPM Q觝u4wVE@PE P臝uKM D9t:uU>EEe[^_U WVS[ê1j$E PtjPƅu<} փVVU RPt&} IMU8uBB8t(Ph0DPNPTNjM8tutэQ1ҋ9sЃƃUDPtjPM QEPW1e[^_ÍvUWVS[jUEpt)6EPuvu݋}щMȃ PyƃueP1ɋU g}u%PhUDPPF URMQPLFFEpe[^_ÉULWVS[zEUMAE싳>8UR6Eątr}эQM;ty:uSMĊ t<:uEjgEuP11Ҹ UEU MQEPEu1ҋE荋MȍMM̀8tt&8:uB@8uPEeEEEURMQE܅QǰIMu U܃}v#M؋E܀|/uM؃}v U؋M܀|/t}tE؋U܀|/t/@E؋pEԅM9Huu܋x t%EԋEԅtdU9Puu܋x u݃}tG1;Es!UԋM9t@;Es UԋM9u;EUԋMEAM}t}щM E􋃰UЍDM؍DPUEԃu􍃴P11Ҹ C&UԍDB MQEPr 芜M؋UԉJ;vE܀8/%1ҋ}G9sMԃ&B9rMUԉJ}t/UUԋTEPMQR赜UԉB MApUԉpME}UMEPmMU Be[^_U\WVS[ÖE􋃬0Pj Eu4P11Ҹ t& 4Pw‹RǃpM1ɋ}}ȍTE }uEEurB}z uBDEB 8/t%gPhuDPvP膎1y9sJ@9rt EЉUcǃ U`0ugPhDPPt3F,RPtPdž( NdžtVTt1F,RP(Pdž, dž(}QM9EMʉװэA$)ĉQRP觙ƺM}EEċM9t}<wBEE8uP"E艃}u SEuEt&URMQPE܅BǰIMu U܃}v%M؋u܀|/uM؃}v }؋E܀|8/t}tU؋M܀|/t /BU؃}tbuȉuE}܀?/uC1ҋM؋E;ut:u@EBw};MI Muu t1&@tEPPWUuMUE58E u 4MAuAEA,fQ,UQM;v8)̉eRju VtEPURV ;Et[TTUeMR%)ĉeDžxu9t`tw tCt(vFUBFft&FMpIV~+FJ`x!׋`xFFpD!ȋ`BFFBFFBF#FBF @bQsB ;tM|xDv<΃ 7)‰U}qM Qj|rMQPU< uet&U‹M@|+Mj|B<7)ljPBP$xɉd} }4e8u<E@xҋx|Ɖd9|B9v1|qu Vjq)PUP  MuD|pUJ9w18P)XUB,9Xr9)M|N V9u4ȉlh|0!9lsl9vm|Bu% Ph1!P軤 )PjVP|BuPh1!Vx9lv1jjj2|v)llPWȣ |dxU9|YMuZuF,PsƒueMA,PuVRxUMeu VE Uu }uMAu}uuFU@t;PjjjMQj2jrj4P@uNO>9tm! Yvo)Ѓw !p)Љ >ڍBw 'TtdPj>yPP誁9uF txFtxFtxVDt(FLxtdPjRyPPXzFPt"xtdPjZyPP,F\txtxFxt!PtF@tFxFXtFxF`t @U~ttF<M@tn} }h<@)ƉP<)UBxu P Mtdu~(t+ExXX;j_Uu6M Q,uVl UE6UǂTHPXXP苊MXu tl0EUMdhEUulp8tVPtF,RPEE8[^_UWVS[%%?)ĉEPUt&pUp W|E1EE;s}vU<tct4EP39t G9u ?/uBW}tPXEF;rUUt U 9P>}t.E8u EPU RPxXE PPcXe[^_ÍvULWVS[zEjEP肏E܃>hU URMQˏEȋU }3.6u؍[uXM̃yt tDEfxYfx* t $UBffv Mq,Q;Ew E TUA)eԃRjURVMQEPg 9t~E؍[UԉUЋMA,9EЃ8x xPB M ;w TU0RjEPkj uVURٍ muċuč,uSUBQQƒyuxt@9s8U REP(t4Ћ$P]PT,8),tRP@EP8Rǃ>uLuA,+E 8DEPRjuE%=@t>u tO}tI8t>@PWj0u QuWۊa{(u(;tC,R蠽Ut,R8RP豄sWdc tzt uG 0<<:0uExt 0TU[^_ÍvU<WVS[w`8wP|Љwt16Q{vuЃutzU~tnF‰U~t\F‰U~tJF‰U~t8F‰UN~t#U‰UA1U1U9uEEMMEU 9tG&MU;Pr#Ph>PPdat&E؋U M9uEjU REPU2%&EM܋t#U jU RjPWU tЃ}uM1/EUt@ $<ȉMԋtdV}tPG@8u P}tE8uu wEPPJ }uEUGvEEM܋U;PsU jU RUREM܋t&U jU RjPEPUx t̓}tM9MuEUGMe[^_UWVS[{EUMEE8UxtsA‰Uyt_A‰UytMA‰Uyt;A‰Uu~t#U‰UA1U1U9u݋EEEEUU:MMu6uUEM@EuXXEUEXt t,UB8u PMQP3uF0@|F,@x4EM1 tt|px8fxu E'pB $<M9t EPxPObU R lMqRbEx!7lRatu u݅PjkPP ]tNE$M A9D:u14:atME xuU$|8u tft|M~tpF‰U~t\F‰U~tJF‰U~t8F‰UN~t#U‰UA1U1U9uEE}EU9tAMU;Pr#PhPPVt&E܋UM9uEjURE PURE0!v?t+EjURE Pj7URUt̓}Mt@ <{э͐%?)ĉQVjtPWbPa}tU:uu wUW11#M1;EUt@ $<ȉM؋tlE 0V}tPUԋB@8u P}tM9uu wEPtP8 }uEUMԋAEEU;PsEjURE PUR?t+EjURE Pj7EPU6t̓}tU9UuEMUԋBMe[^_ UA(t@ ÍvUFNVT!!)ʉT$#FU$jw7l}/ExNV1ɉ&T׋F @bQsGMO } EE\9,\A,@Eyt}A$PJ}tnBEqPO\pt&6UROtvuutd\ BEEUB\t@EB`@EEt&u~ht5FtH}u UE9tMF @Euu F PU1mvUUh<}}dUM M`<tHFlM9@EuVuU EEM9Mr UB0@E1ɅtHUʋM9vMFlu;tG}tA9s=Ezt%~PhPPFIu09rċU@E;Mdt&MQu Fu$MMMu6uEEE҉|uUMV|CuF UB;uT|%|u 9t.9u*|MAEЋA||uuFFMЉ}t,Ext#F1MqjWMQpMЉ')uV2EЋMAjWrMЉuFEЉF UB0UЅtr|H+S ܫLL̫t&E0U2+uM1vRMA9w s@X8t5EP,MBPuP4Pjx!EЋMQ@9vƒRVuVRt&1ɋ|ExEE9E@;MUxM xuVEtE҉puUx2p#tF UBƋt;uYp%pu 9t 3v9u,|uFEFvpȃpuUBUuF82UrjQpMuuFEFt&UB0UtrpH+tV\L9llt&x0vx2v+xx1RtA9w sCX8t8EP,tBPuP4PjEtQ@9vƒRVxVZPt&1ɋpEEE9Epld}tkEx u5EpuPVjCjQE@ pjƈ‹E0u뤋E}t+Urr2cRMI MuՍH[^_ÉU,WVS[öE܉׃PuVNAE܋PV11߈vU WVS[NuV >jvtP1ɉ興Fe[^_ÐUWVS[E؉UԉMЍDI%?)ĉeE$U؉PEH HE$ Eu9usRvEċUԋuYuVvuEPXUEq }U`u2T$$D$}ȉgeE$ }EM@E=t =u}wuEj$VAtjP舄E},8tP1ɉ1舄IMU8uMB8t%PhPP=aNjM8t"u t&tэQ1ҋ9sЃEUD$)ĉjPVMQ%ƀ>uOu>u4P1ɋU1誃i}WtPNt&uE8uwt)UB8u PVṔEPXUE2 E;4P/t)MA8u PV4PVEPXUE軂 }tE E}$GD$GD$EG}tEUMBUM`D$RBtp9Huzte}wB9EuUȋ@BEPt@ B EP t@BUF@BVEBUBtP UF}t&UFBFBu}gE$ EPt@ B EP t@BUD$@BT$EBUBtP UD$B E9EuuȉuEU:f}toMuAMP‹}|uE؋PtP1ɸ ̀M EPuVRF}̃?tE̋@E̅t8u}<8u }tUM؋|tGu8t#PhPP9t&RSE P~u؉|uVP1ɸ UD}؉EEE̅tRv}tŰBt MMu؋}̋GEŰBJM̅uu؋92t"PhPP8vE}ċE;MtMuFx;Ms`Ћ}؋};uAxE؋}O9sDA9rU} t&A;trEċM؋u;qEPR}|DEE;EU؋MċEE|Axut}9xtt&EuM94uuF;t|~|tZ+E<MtB;EuU؋|4W|P|AP2BM؋|}4|U؋|;uxxM;M Uu؋|}tU1}tEu1.}X[^_vUWVS[Îlj֋W0G,@EGtpFEmMJMU6u<tPjHP PR6F u|t>@UP$xt%M6ujjPXEd{(MEEjjXEJ{‹EtP1Q8uEЍe[^_ÍvU,WVS[zljUM<E0U2W0G,@EGt@EMAJM<t+PhP P5B t7@p$xt!MUjjPXE/z'MEEjjXEzƒEtp1 q78uE0VMQEЉe[^_Ít&PQRT$D$ ZY$&PQRL$T$D$ ZY$t&UWVS[΃}u bE8tjЃ xuщ}փPxBt7VMQr?RQP?x4AuPP1t$hPR1t&Pt yyPMQ9tPPuQuPPj" 0j@U WVS[Njut VRW V[xe[^_UVS[TPLDž\8tjЃE`P4ƃ:tXPjЃvXURLЃ:tEPj ETP1Qv:tEPjEXT\P1t8[^UWVS[rEUϋ8tjЃE􋃀8tjjЃ ǃEWEЃ8t VjEe[^_ÍvU WVS[þu Nu ~Hu ~|t+t PPUtFHt@URURU RЃV|t<@E>z19s"t&EPURE PЃF;ure[^_ÍvUWVS[ƓEUM􋸘l>tEPREP6tywtqt(UB8u PP^sU@‰U19s%EPUREPUЃG9r1tG sE!UREPURU|4NuG ys0e[^_&U׉MEjPD<ƃ|BEPVjp|#ẺtjVjURPjXJE V9<Ex[^_ÍvULWVS[öeEE &UUMM̃} }uFuЃ}uw8E=vxPjoPP\)M싃EuN)E хu߉9vH09wE:E }?~xPjxPP(EUM<uЉuE UMMEut<%t } t< u}?~xPhPP|(E+EŰMȉt Eu1EU<%bE EBU:0uE0BUM9*uEuvuAMUE}EuUU}N )}9хu߉u؋EE܋EԉEuUUE1U<ы}|}Fv$)ĉ1U4PL/FvGE;FuR EPW'9F}} U}č}ȋEE̍UE1}}v<ы}|}Fv$)ĉ1U4P.FvE}čUȋ}}̍EE1UU<ы}|}Fv$)ĉ1U4P.FvE}W:t1Q11^Ee[^_ U|WVS[VEЉỦMEEE@,u10&@EEЋEUЋUH}Ћ?Mf9EEԉ uEUUN|)9хuu؋UU܋EԉEuUE1U<ы}|}Fv$)ĉ1U4P,Fv}ЋW:u Q1ɋEfEEURU`8tct&wMQ$ЉUwu,t"6MQ$tv}u uރ}t} uEkUЋM4v}W:$v6EP$tvuutUЋMEE}E;rE}u"$PhP;Pv}t UunuvMN}ЋG8t 8F%PEPEP EF%;EvEF t뛍vUB t ‰U=}t*MQ}B%;EvEBu}juFVc‹EЉ$uTE MЉ @4}tq}lj}׉uvFLLEFEMAD F t뾋UB t‰U맍&}tPMq}7 Fu/F%UЋ$VTUD Ft뻋Ečx[^_UWVS[ځUM1ƅt+1uMUa% Njv uՉ[^_Í&U<WVS[{($DžDžDžM|9sWv?u>Gt8ڋG!GD!;s;v ;rǃ(ƒD$)Љ艃ǃj'H ѭQ1w ǃ2v ǃ RT@1󫋃EElp鉍t=xjPR Es$ҋ>эD$)ĉ $P Rz&/@j Q6P\&P%hhB P,ǃu.hP0P REPWj<`|E%=t:u0W+hLPVmP QuЉ E̋M%%?)ĉRjP$j#PW,u80W7+hPVP RH#PQWo+ƃu p8t̅|o;u;tJW*tQP80 R^t&jWjjQjX8 u@0W**h,PVP PGPjW)8PE EuC󥋅@ǃl󥋃@Sxƃl Bj PN\u5RQ?7tPjwj$ǃ9stxR<ɋT:1@΋BfDf Bu)‰9sz1=vev1Fv11Ǻ1WVQ6ǃ[^_ÉUWVS[y)U9ErE)U 9E  u 4ru҅<ы;Umftt&Wu/jQ-t,8u8tыIj\-;Lu􋃈B!)R7-8tR,Q0PU ҋ4[^_ÉUÍvUlWVS[sE8>t&JMHM}uc@EPj1E1Us\PPjVF~҃MQx4uE0AЉMuu<uUN)9хu8Uu$U&Jȃ8uWEEMPEPjE8e[^_ÉULWVS[jrEUMh8#ƒ}ȉMEt }sEEM؅u}uNjpREu P11Ҹ ^Su6F}M$)ĉeEEtL1}s8\EM<I}ELM1G}Eu}tEu}UTFuM9Mt>PhUTPsP- }uuV?}UDBPEvIu}D@Fu@;ErM}7PQE}uVEUMqFrЉBB q1PD/}GUtME}G}^Ur rPffEff E~ /   Š~EߊEފE1+\oToJo:o,oo on/Aef/A[f/U߈QAK1AD&1EވAA0v1UfQA1EfAU݈QA1QAMq1PffEff E~ /   Š~E܊EۊE1+',n'nn nnmmm/Rf/Kt&f/U܈V:v3MۈN)EfFt&UfVMڈNVuuċ}O}t&uUŰMMċuNuȍt&E}UttPuffEff E~ /   Š~EيE؊E1+'llllll|lgl/Aef/A[f/UوQAK1AD&1E؈AA0v1UfQA1EfAU׈QA1QAM̉MKt&}u.Ut4PffEff E~ /   Š~E֊EՊE1+d|ktkjkZkLkt9WEP6u<=ut&Buɉ1e[^_ÐU WVS[g}u"LT!‰$;r]t8!ƃjjj"jVj" uPjNPP{;te[^_ÐU WVS[guu VkGǃVjW e[^_US[fE;u[UVS[ïfuE uPG]&;tPjtPPPF9tPjwPPZe[^ÍvUE@1ÍvUS[ fu u;vUWVS[eUuЃ+D፴&LeTe4e4eDe4e4e4e4e4e4ede1ρGu3H 1ѿs)1ρGu1ѿs1ρG&1_Ãt8t@t8t@t8t@_É'UVuU F Bt8t)‰ ^Ð&UWVS[_}E 48u1d9st 8tD@u Azt29s,tBzt@zt Azu9v)[^_Ít&UWVU }EviMAM MBtm8uiMAM MBtV8uRMAM MBt?8u;MAM MBt(8u$NutMAM MBt8uOuE)‰^_ÐUWVU uEEIvtumBMtNBMA}Gt=BGt.BAt#Mt1BAtBAt BAuӉ+E)ƉputBANt uANuE^_WV1t$ L$͉f8uFth8ukFtO8uRF<uF uF F uF 1ׁG1ʿs1ׁGuV1ׁG1ʿh1ׁGoVsf1ׁGu[1ʿ61ׁG=V s.1ׁGu#1ʿ1ׁG"8ut 8uFt8uFt8uF^_Í&U WVE uU~NvFUtuU9UuPUt\xFtU;Ut FtH;UuFt;;UuNN}t#AG9utAG9t}u1^_Ív'VWD$ T$t$H։fʨ8g@N?8O@N'87@N&11ρGH11ρGH11ρGH 11ρGqr[1st1ρGuir;1sT1ρGuIr1s41ρGu)t8t0@Nt 8t(@Nt8t 1t@t @t@_^Ðt&UWVE}u )9r*vك)G&Ƌ}ǃv%)ONON&E^_É'UWVu}E v% ‰ ‰Љك)E^_ÍvUWVE}u vك)^_Ðt&U1MtAÉD$L$)t$TPtTPt TPu@@@ UWVUE׋u vك)t&^_Ðt&U WVS[X}U 7u1Stzu%t;8u!t,PFP, RVt @ t&e[^_WD$T$ ։fʨt)8@t8@t8@1sd1ρGuYH1sH1ρGu=H1s,1ρGu!H 1s1ρGu똃t@t @t@_Ív'ڋ\$z̀=sS[1ҁïV)RY[߉'ڋ\$̀=sS[1ҁpV)RSY[v'̀=sS[1ҁ7V)RY[ߐU\WVS[V >un‹E} MS̀[E=v ؉EEu:&t$uUBX9B t J JXB\E}:M} Sj̀[Ɓvbމ0}}EMAA}ĉyXA\A EȉAEʉAẺAEΉAEЉA A$A(EԉA,A0E؉A4U܉Q8A<EA@ADEAHALEAPAT1[^_É'U\WVS[nT >unK‹E} MS̀[E=v ؉EEu:&t$uUBX9B t J JXB\E}:M} Sl̀[Ɓvމ0}}EMAA}ĉyXA\A EȉAEʉAẺAEΉAEЉA A$A(EԉA,A0E؉A4U܉Q8A<EA@ADEAHALEAPAT1[^_É'ST$L$ \$̀[=sS[1ҁùR)RY[ߍvڋ\$̀=sS[1ҁR)RbY[߉'ST$L$ \$̀[=sS[1ҁ9R)RY[ߍvST$L$ \$̀[=sS[1ҁQ)RY[ߍvST$L$ \$̀[=sS[1ҁùQ)RY[ߍvڋL$\$!̀=sS[1ҁ{Q)R^Y[ߐt&UUR%Eu[E}MME7EMT9vփVEU4‹MQE)t Eu9u|Ã}WEPURƃ}t MQ&e[^_Í&'US[óDu[ÐڸZ\$̀=wS[1ҁoD)RRY[߉'ڋL$\$[̀=sS[1ҁ+D)RY[ߐt&ST$L$ \$}̀[=sS[1ҁC)RY[ߍvUS[CUD)‰;s fP[UVS[tCuuPu14jPjǃj4PjtEthhP1*]Ív'UVuU )ЍHBu^ËT$D$1QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQjjjjjjt' Ht Ht H uӍB8 tH8 tH8 t H8 u@@@u1Í'ST$L$ \$h̀[=sS[1ҁ=)RY[ߍvU WVS[<Ƌ>hP|Pǃ>t ǃ ǃ8e[^_ÐUlWVS[r<u>uR1 t&uB}9EPVjF|NjE%=@t뫍&hVRE|EPEPjr|WE%=@u?jjEPG|(EԿ = vǃG0PjƃucNj7EP7F0F~EtjFPe[^_Í'U WVS[;uuFtFP> tFPVaW e[^_Ít&U WVS[Î:}sEtGPG 9Gr2OWku 0U1-&G GWwF‰WFG>tt GPe[^_Ít&'U\WVS[9EUM􋃸8E0EEUU wуMЃ$)ĉe}MUS̀[E=v؋UEE*M9EE}}UU9My}؃}ԋ1yʋBR ẺUЊIMˋE0ỦPM19u09u,E̋UЃ}u}w E̋U؃ډ t'}9}KE̋UЉE܉UMԋUfJEˈB E؃PEPЃ PXUUMMEE9E})}h 0EQEM)ыUJ9vʋMMB$)ĉeċ}S̀[E=vUډE}u(jE܋URPURM)M}<9FPEЉEEE9EvAU9UuPhPPJjEƉWVURTFEMFAfQA FM V PRQz}}FƃEE9OE)EEe[^_ÍUWVS[Ë6}u2} MSk̀[ƁNމ0 8`} S̀[Ɓvމ01}`dMQfAu EulA t&E}G W 19uu9uqpUBtBxB|BEUMA Q$fA(EA,‰9u$;MuE}G0EG4‰9u;Mt4K[&EUB8B<EB@BDEBHBLBPBT1'8& M\} Sk̀[Ɓvމ0}t }t}\E}GfGEĉG EȉGEʉGẺGEΉGEЉG G$fG(EԉG,E؉G0E܉G4EG8G<EG@GDEGHGLGPGTt&1[^_Ðt&US[Ð3E 1Ҩ@tUR̀Pu]UWVS[Z3}E Uщ‰M΋EыU Sø̀[ǁv߉8uEU[^_Ívbad dynamic tagelf_get_dynamic_infodynamic-link.h! "bad dynamic tag"info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17elf_machine_rel../sysdeps/i386/dl-machine.hr_type == 6 || r_type == 7elf_machine_rel_relative((reloc->r_info) & 0xff) == 8--list--verify--library-path--inhibit-rpathUsage: ld.so [OPTION]... EXECUTABLE-FILE [ARGS-FOR-PROGRAM...] You have invoked `ld.so', the helper program for shared library executables. This program usually lives in the file `/lib/ld.so', and special directives in executable files using ELF shared libraries tell the system's program loader to load the helper program from this file. This helper program loads the shared libraries needed by the program executable, prepares the program to run, and runs it. You may invoke this helper program directly from the command line to load and run an ELF executable file; this is like executing that file itself, but always uses this helper program from the file you specified, instead of the helper program file specified in the executable file you run. This is mostly of use for maintainers to test new versions of this helper program; chances are you did not intend to run this program. --list list all dependencies and how they are resolved --verify verify that given object really is a dynamically linked object we can handle --library-path PATH use given PATH instead of content of the environment variable LD_LIBRARY_PATH --inhibit-rpath LIST ignore RUNPATH and RPATH information in object names in LIST cannot allocate memory for link map dl_mainrtld.c_dl_rtld_map.l_libnamelibc.so.55 6 :/etc/ld.so.preload: i == npreloads_dl_rtld_map.l_prev->l_next == _dl_rtld_map.l_next_dl_rtld_map.l_next->l_prev == _dl_rtld_map.l_prev statically linked %s => not found %s => %s (0x%0*Zx) %s found at 0x%0*Zd in object at 0x%0*Zd Version information: %s: not found[WEAK] %s (%s) %s=> %s

%s (%s) %s: %s: %s libsdisplay library search pathsrelocdisplay relocation processing"filesdisplay progress for input fileBsymbolsdisplay symbol table processing bindingsdisplay information about symbol bindingversionsdisplay version dependenciesallall previous options combinedstatisticsdisplay relocation statisticshelpdisplay this help message and exit ,:warning: debug option `%s' unknown; try LD_DEBUG=help Valid options for the LD_DEBUG environment variable are: %s%s %s To direct the debugging output into a file instead of standard output a filename can be specified using the LD_DEBUG_OUTPUT environment variable. /var/tmp/var/profile=WARNDEBUGVERBOSEPRELOADPROFILEBIND_NOWBIND_NOTSHOW_AUXVHWCAP_MASKORIGIN_PATHLIBRARY_PATHDEBUG_OUTPUTDYNAMIC_WEAKPROFILE_OUTPUTTRACE_LOADED_OBJECTSASSUME_KERNELLIBRARY_VERSIONLD_AOUT_LIBRARY_PATHLD_AOUT_PRELOADLD_PRELOADLD_LIBRARY_PATHLD_ORIGIN_PATHLD_DEBUG_OUTPUTLD_PROFILEGCONV_PATHHOSTALIASESLOCALDOMAINLOCPATHMALLOC_TRACENLSPATHRESOLV_HOST_CONFRES_OPTIONSTMPDIRTZDIR/etc/suid-debugMALLOC_CHECK_ number of relocations: %lu number of relocations from cache: %lu bad dynamic tagelf_get_dynamic_infodynamic-link.h! "bad dynamic tag"info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17/lib//usr/lib/ {ORIGIN}{PLATFORM}expand_dynamic_string_tokendl-load.c(l)->l_name[0] == '\0'cannot allocate name recordadd_name_to_objectlastp != ((void *)0)./cannot create cache for search pathcannot create RUNPATH/RPATH copy:cannot create search path arraysystem search path_dl_init_pathspelem->dirname[0] == '/'l->l_type != lt_loadedRUNPATHRPATH:;LD_LIBRARY_PATHlosel->l_next == ((void *)0)cannot stat shared objectfile=%s; generating link map cannot create shared object descriptorcannot read file dataELF load command alignment not page-alignedELF load command address/offset not properly alignedfailed to map segment from shared objectcannot dynamically load executablecannot change memory protectionscannot map zero-fill pagescannot allocate memory for program headerobject file has no dynamic section dynamic: 0x%0*lx base: 0x%0*lx size: 0x%0*Zx entry: 0x%0*lx phdr: 0x%0*lx phnum: %*u shared object cannot be dlopen()edcannot create searchlist search path=%s:%s (%s from file %s) (%s) ELFGNUfile too shortinvalid ELF headerELF file data encoding not big-endianELF file data encoding not little-endianELF file version ident does not match current oneELF file OS ABI invalidELF file ABI version invalidinternal errorELF file version does not match current oneELF file's phentsize not the expected sizeonly ET_DYN and ET_EXEC can be loaded trying file=%s file=%s; needed by %s find library=%s; searching cannot open shared object fileAT_HWCAP: %s /etc/ld.so.cache search cache=%s ld.so-1.7.0glibc-ld.so.cache1.1_dl_load_cache_lookup../sysdeps/generic/dl-cache.ccache != ((void *)0) trying file=%s undefined symbol: symbol=%s; lookup in file=%s do_lookup_versioneddo-lookup.hversion->filename == ((void *)0) || ! _dl_name_match_p (version->filename, map) file=%s; needed by %s (relocation dependency) relocation error
protectednormalbinding file %s to %s: %s symbol `%s' _dl_lookup_symbol_skipdl-lookup.ci < (*scope)->r_nlistsymbol , version not defined in file with link time reference (no version symbols)binding file %s to %s: %s symbol `%s' [%s] _dl_lookup_versioned_symbol_skipbad dynamic tagelf_get_dynamic_infodynamic-link.h! "bad dynamic tag"info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17 (lazy) relocation processing: %s%s cannot make segment writable for relocation%s: Symbol `%s' has different size in shared object, consider re-linking elf_machine_rel_relative../sysdeps/i386/dl-machine.h((reloc->r_info) & 0xff) == 8%s: profiler found no PLTREL in object %s %s: profiler out of memory shadowing PLTREL of %s cannot restore segment prot after relocunexpected reloc type 0xunexpected PLT reloc type 0xDST not allowed in SUID/SGID programs_dl_map_object_depsdl-deps.c(l)->l_name[0] == '\0'empty dynamics string token substitutioncannot load auxiliary `%s' because ofempty dynamic string token substitution load auxiliary object=%s requested by file=%s errstring != ((void *)0)load filtered object=%s requested by file=%s cannot allocate dependency listmap->l_searchlist.r_list == ((void *)0)cannot allocate symbol search listmap->l_searchlist.r_list[0] == mapbad dynamic tagelf_get_dynamic_infodynamic-link.h! "bad dynamic tag"info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17fixupdl-runtime.c((reloc->r_info) & 0xff) == 7profile_fixupout of memoryDYNAMIC LINKER BUG!!!: error while loading shared libraries%s: %s: %s%s%s%s%s calling init: %s calling preinit: %s _dl_finidl-fini.c_dl_nloaded > 0i < _dl_nloadedi == _dl_nloaded calling fini: %s _dl_debug_vdprintfdl-misc.cpid >= 0 && pid < 100000niov < niovmaxinvalid format specifier! "invalid format specifier"checking for version `%s' in file %s required by file %s no version information available (required by )match_symboldl-version.cdef_offset != 0unsupported version of Verdef recordweak version `' not found (required by version ` of Verneed record _dl_check_map_versionsneeded != ((void *)0)cannot allocate version reference tablegmonseconds.profile%s: cannot open file: %s %s: cannot stat file: %s %s: cannot create file: %s %s: file is no correct profile data file for `%s' %s: cannot map file: %s Out of memory while initializing profiler AT_HWCAP: %s /proc/sys/kernel/osreleaseFATAL: cannot determine library version FATAL: kernel too old AT_EXECFD: AT_PHDR: 0xAT_PHENT: AT_PHNUM: AT_PAGESZ: AT_BASE: 0xAT_FLAGS: 0xAT_ENTRY: 0xAT_NOTELF: AT_UID: AT_EUID: AT_GID: AT_EGID: AT_PLATFORM: AT_HWCAP: AT_CLKTCK: AT_FPUCW: AT_DCACHEBSIZE: 0xAT_ICACHEBSIZE: 0xAT_UCACHEBSIZE: 0x%s%s cannot create capability list_dl_important_hwcaps../sysdeps/generic/dl-sysdep.cm == cnt/mallocdl-minimal.cpage != ((void *) -1)reallocptr == alloc_last_blocknew == ptrCannot allocate memoryInvalid argumentNo such file or directoryOperation not permittedInput/output errorPermission deniedError : Inconsistency detected by ld.so: %s: %u: %s%sAssertion `%s' failed! Inconsistency detected by ld.so: %s: %u: %s%sUnexpected error: %s __strtoul_internalbase == 0fpuvmedepsetscmsrpaemcecx8apic10sepmtrrpgemcacmovpatpse36psn19202122mmxosfxsrxmmxmm227282930amd3di386i486i586i686/dev/null0123456789abcdefghijklmnopqrstuvwxyz/proc/self/cwd../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../...//proc/self/exe//dev/null__getdents../sysdeps/unix/sysv/linux/getdents.cdp != buf`  0   o$ oov o#<0"2BRbr"2BRbr,043 45P5404055 (566З6@( 600046x68086@'D6H6d6h6l6$0the `llseek' function may be dangerous; use `lseek64' instead..symtab.strtab.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_d.rel.dyn.rel.plt.text.rodata.data.dynamic.got.bss.gnu.warning.llseekl! `)``1ov v >o$ $ M  V   Z_0e , m00<s<0<0|0022 2@ 2T6@R Oz  d #l3F 4@. Bp5 KF ^r l- |P+D 22+F 2 + 2  3     (3 /46= Kt7 ^  hd8 x222222,B B,  Li    dN XQ  &P .\ 70\ H2N2X2c b` pc w ty k| ~ @  O M P dH  22   I O  (c   g Y 22#2,272D2U2_2f2m2r2v2|22 2 # 6  333     P   ?  V    2  P  g    33 ( Z  m : " T ' H 63@3I3R3Z 3b3 L P r lx vp    { 3 L  D K  ? ! @A    tw- xw 0 l pv '/ 0,0 Ft  [ f(e y4   p| ; <0   \ = `7 = 4 3P  %/ ,0$ 8 Q= X 4e; l= v`=  = i  5 P P  P 5 80 i ; %40 .= := @@7 V40 ``7 e`6 k y  ~55i   ( P P  7 56 H = * > E= K40 S  W6`. sl @A H< ` P p З P4   = ؙC  `=    @  lW ( L . p > F I hl R 6 c P" r  | 0$ } @($ P7 Pg x2 = 6 E P4 0 lW  e  i  = " 8 ) ` 2  9 ; C hl J  Q 00 ` ` m  x = 7  46 P7 P; x2 0 x6  80 86 @'  ) #  4 | ? ; H pv Q L U xz j D6t 3{ H6 $ `6 i = =  Pg n } = P; | d6     h69 P4 B l6T p6e $0 z P7  `v $     0 <0 0 2 4 . |  4 tl  41 4B (0 O 4f  w p 1 5  5 " i  `l 5%5<5Qd c5t6@"  0   654  60" U 4P> IU_ t$6` (6&  l4 ,6b@ @  06dT " 0 00 @<6K \@6lL6yP6N p t6 $" m  _dl_start_dl_start_finaldl_mainprint_statisticsrelocate_doitmap_doitversion_check_doitmatch_versionprocess_envvarsprint_missing_versionlibrary_pathpreloadlistprint_unresolvedversion_infodebopts.206process_dl_debugany_debugunsecure_envvars.210Letextsystem_dirssystem_dirs_lenis_dstexpand_dynamic_string_tokenadd_name_to_objectcurwd.168decompose_rpathncapstrmax_dirnamelenmax_capstrlencapstrrtld_search_dirsenv_path_listlose_dl_map_object_from_fdprint_search_pathexpected.187expected_note.188open_verifyopen_pathdummy_bucket.195_dl_cache_libcmpcachecachesizecache_newundefined_msgadd_dependency_dl_do_lookup_dl_do_lookup_versionedmsg.137openauxfixupprofile_fixup__libc_tsd_DL_ERROR_datareceivercall_init_dl_debug_vdprintfmatch_symbolrunninglowpctextsizekcountsizehashfractionlog_hashfractionfromlimitkcountnarcspdatatosfromsfromidxnarcs_dl_auxvauxvars.180alloc_endalloc_ptralloc_last_blockcheck_one_fdno_syscall_getcwdhave_new_dcachegeneric_getcwddots.123__atomic_writev_replacementprofil_counterpc_offsetpc_scalensamplessamplesoact.18otimer.19__restore__restore_rttryopen_o_directoryo_directory_works__evoke_link_warning_llseeklongjmpstpcpy__libc_sigactionstrcpy_dl_setup_hashunsetenv__longjmp_dl_receive_errorwritev__getpid__libc_multiple_libcs_dl_important_hwcaps___xstat64_dl_reloc_bad_type__getdents__strnlenmemmove_dl_new_objectmunmap_DYNAMIC__ffs__libc_fcntl_dl_load_cache_lookup__write__mmap__mprotect__have_no_fcntl64errno__rawmemchr__getcwdgetpidgetpagesize_dl_sysdep_start_cleanup__read_dl_rtld_mapmemcpysetitimerreadlink__old__xstat64__open__llseek__strerror_r__have_no_getdents64__strsep_dl_finireaddir__strtoul_internal_lxstat_dl_rtld_libname2___brk_addr__lseek64mempcpy_environ__libc_readlseek_dl_next_ld_env_entry__environmmap_Exit__sigjmp_saveffsl_dl_bind_not_dl_num_relocations__libc_lseek64strnlen_dl_x86_platformsrawmemchr__lxstatuname_dl_platform_dl_skip_argsstrrchr__libc_check_standard_fds__setitimer_dl_runtime_resolverindexwriteenvironffs_dl_argc_dl_debug_printf_c__profile_frequency__stpcpy_dl_init_pathsmemchr__readdir___fxstat64_dl_runtime_profile__libc_open64_startstrstrread_dl_signal_cerror__readlinkstrncmpstrncpy__opendir__brk__old__fxstat64sigfillset__profil_dl_rtld_libname_dl_get_originsigaction__getpagesizesbrk_itoa_lower_digits__libc_closeindex__bss_start__libc_open__have_no_stat64memsetopen64_dl_dynamic_weakopendir__assert_failllseek__lseekstrcmp__memchrgetcwd__mempcpyprofilstrsep_dl_hwcap_mask__ubp_memchr__strsep_g__libc_lseek__uname_dl_start_user__libc_missing_rt_sigs__closeaccess_edata_GLOBAL_OFFSET_TABLE__end__sigaction__curbrk_dl_verbose_dl_x86_cap_flags_dl_dprintf__errno_location__closedir__munmap__writevbrk__assert_perror_fail_dl_hwcap_errno_dl_initfirst_setjmp_exitlseek64open__libc_write__fcntlstrchr_dl_show_auxv__sbrkmprotect__accessclosedir_dl_osversion_dl_sysdep_read_whole_filefcntl_dl_num_cache_relocations__open64_dl_inhibit_rpath_dl_search_paths_dl_correct_cache_idclosestrpbrk__libc_internal_tsd_set_dl_debug_printf_dl_check_map_versions__xstat64@GLIBC_2.1_dl_nloaded_dl_lookup_versioned_symbol_skip__pthread_mutex_lock_dl_profile_output__libc_stack_end_dl_debug_fd_dl_initial_searchlist_dl_sysdep_start__fxstat64@GLIBC_2.1_dl_init_dl_platformlenGLIBC_2.1.1_dl_debug_mask__pthread_mutex_initmalloc_dl_lookup_symbol_skipGLIBC_2.1_dl_lookup_versioned_symbol_dl_profile_dl_global_scope_alloc__libc_enable_secure_dl_lookup_symbol_dl_global_scope__libc_internal_tsd_getcalloc__pthread_mutex_unlock_dl_lazy_dl_debug_state_dl_argv_dl_dst_substitute__pthread_mutex_destroyGLIBC_2.0_dl_main_searchlistrealloc_dl_check_all_versions_dl_debug_initializeGLIBC_2.2.3GLIBC_2.2__xstat64@@GLIBC_2.2_dl_origin_path_dl_start_profile_dl_clktck_dl_relocate_object_dl_dst_count_dl_starting_up_dl_unload_cache_dl_out_of_memory_dl_mcount_dl_init_all_dirs_dl_map_object_dl_load_lock_dl_fpu_control_dl_loaded_dl_signal_error_dl_profile_map_dl_all_dirs_r_debug_dl_catch_error__fxstat64@@GLIBC_2.2_dl_pagesizefree_dl_map_object_depsELF 4 4 (444     (@ GNU " !$T      47'"#"M@( d{" __gmon_start____cxa_finalize__deregister_frame_info__register_frame_info__ctype_get_mb_cur_max_nl_current_LC_CTYPElibc.so.6libBrokenLocale.so.1GLIBC_2.0GLIBC_2.1.3Al9ii ysi ii   $(, 0! US[L\'[ hhhUS[,t[ÉUS[èud(t.0 P Ћ 8u⃻ tP.ǃ]ÍvUS[ [ÉUS[t0PP]ÐUS[[ÉUS[û$@T[ÐUVS[Çt Ѓ>u[^ÐUS[T[ÍUS[8w[/lib/ld-linux.so.2 y   T@ooo$ooo  .shstrtab.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.interp.data.eh_frame.dynamic.ctors.dtors.got.bss    '/oD<o8Ko$$0Z TT@c  l%g@r  x~    044 4 ELF 44 (444  , ,@,, GNU7<25;0*/"6)34#'7&(9% :$!-+8,.1< t  4    ,     ,,,,---(.a/ )7'"YpPX  j5>#"XkR;;{",d9# Mp )MW k[ __gmon_start____cxa_finalize__deregister_frame_info__register_frame_infogai_cancelpthread_mutex_lockpthread_mutex_unlockgai_errorrealloccalloc__errno_locationpthread_attr_initpthread_attr_setdetachstatepthread_create__assert_failpthread_cond_signalgetaddrinfopthread_cond_timedwaitpthread_exitfree__gai_sigqueuegai_suspendpthread_setcancelstatepthread_cond_wait__gettimeofdaypthread_cond_destroyabortgetaddrinfo_agetpidmalloclibc.so.6libpthread.so.0libanl.so.1GLIBC_2.2.3GLIBC_2.1.3GLIBC_2.0GLIBC_2.1zsi @si si ii ii ii  ,$,,... . .* .1$.;----- -!-"-#-$-&-'-(-)-*-+-,-.-/-0-1-2-3-4.5.8.:US[È" [ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPUS[ì t[ÉUS[| udt.x0'PЋ8u⃻t Pǃ]ÍvUS[[ÉUS[ttP P]ÐUS[ä[ÉUVS[Ë| EJt ~F|~e[^ÐUE@ÐUVS[@9r,rPt1 ujVu1A t&AN鋓BЍe[^ÐUS[O‹tt&9Pt @u1[ÍvUS[1ыQt 9Buu=&:t *t&u BBA;u1[ÍvUVHN u vhuV2v[ue[^_Í&'ULWVS[U %?)ĉe؉%?)ĉeEEEE|O1;u M؉M1Eu vUċMtQxuK(‹EċMԉt7ME؉LB M؉9EDD DMȉJ EEENuu }tE̙;u XELEPj}u|uVat&juV~V)ЍU܋uFBEE܃B=ɚ;~ 6eĉBE܃R|uVẼ1;u }cU~tIxuCMԋt2J R t(u؍9t t9ut;u |juEP6 tj}t%}nu E}u E̘E|E̍e[^_Ív'UWVS[ÇE%?)ĉeEE}v}u EEE|1U9U}:uM tUt E@EEG;}|ɋEu<|}4u~um1‹E{}eEEEU%?)EMMuu~rxDž|EE׉ᐍt&|E0t/uqB EAA Axr E@Ex|OuEPj|UREjuMQ tet&uDPxu EExu EEExU}~kxDMEU}xTuE0t.AB AxqEAu1EB E@EEEOuEx}u|EX[^_Í'UVS[[t Ѓ>u[^ÐUS[([ÍUS[ w[__gai_enqueue_requestgai_misc.clastp->next == newphandle_requestsrunp->running == 1runp->running == 0/lib/ld-linux.so.2 ,-@    -4  Po< oot ooo,B R b r   " 2 B R b r ,`,x,.shstrtab.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.interp.data__libc_subfreeres.eh_frame.dynamic.ctors.dtors.got.bss   '/ox<o< < 8Kot t pZ  Pc 4 4  l  %g, , r x~k ,  ,,,---(.(8(This package is maintained for Debian by Bdale Garbee The upstream source is available from http://www.eecis.udel.edu/~ntp Copyright: The following copyright notice applies to all files collectively called the Network Time Protocol Version 4 Distribution. Unless specifically declared otherwise in an individual file, this notice applies as if the text was explicitly included in the file. /*********************************************************************** * * * Copyright (c) David L. Mills 1992-1998 * * * * Permission to use, copy, modify, and distribute this software and * * its documentation for any purpose and without fee is hereby * * granted, provided that the above copyright notice appears in all * * copies and that both the copyright notice and this permission * * notice appear in supporting documentation, and that the name * * University of Delaware not be used in advertising or publicity * * pertaining to distribution of the software without specific, * * written prior permission. The University of Delaware makes no * * representations about the suitability this software for any * * purpose. It is provided "as is" without express or implied * * warranty. * **********************************************************************/ The following individuals contributed in part to the Network Time Protocol Distribution Version 4 and are acknowledged as authors of this work. 1.Mark Andrews Leitch atomic clock controller 2.Viraj Bais and Clayton Kirkwood port to WindowsNT 3.5 3.Karl Berry syslog to file option 4.Piete Brooks MSF clock driver, Trimble PARSE support 5.Steve Clift OMEGA clock driver 6.Casey Crellin vxWorks (Tornado) port and help with target configuration 7.Torsten Duwe Linux port 8.John A. Dundas III Apple A/UX port 9.Dennis Ferguson foundation code for NTP Version 2 as specified in RFC-1119 10.Glenn Hollinger GOES clock driver 11.Mike Iglesias DEC Alpha port 12.Jim Jagielski A/UX port 13.Jeff Johnson massive prototyping overhaul 14.William L. Jones RS/6000 AIX modifications, HPUX modifications 15.Dave Katz RS/6000 AIX port 16.Craig Leres 4.4BSD port, ppsclock, Maganavox GPS clock driver 17.George Lindholm SunOS 5.1 port 18.Louis A. Mamakos MD5-based authentication 19.Derek Mulcahy and Damon Hart-Davis ARCRON MSF clock driver 20.Lars H. Mathiesen adaptation of foundation code for Version 3 as specified in RFC-1305 21.David L. Mills Version 4 foundation, Spectractom WWVB, Austron GPS, Arbiter GPS, CHU, Heath, ATOM, ACTS, KSI/Odetics, IRIG clock drivers; PPS support; precision kernel; NTPv4 changes 22.Wolfgang Moeller VMS port 23.Jeffrey Mogul ntptrace utility 24.Tom Moore i386 svr4 port 25.Rainer Pruy monitoring/trap scripts, statistics file handling 26.Dirce Richards Digital UNIX V4.0 port 27.Nick Sayer SunOS streams modules 28.Frank Kardel PARSE driver (14 reference clocks), STREAMS modules for PARSE, support scripts, syslog cleanup 29.Ray Schnitzler Unixware1 port 30.Michael Shields USNO clock driver 31.Jeff Steinman Datum PTS clock driver 32.Harlan Stenn GNU automake/autoconfigure makeover 33.Kenneth Stone HP-UX port 34.Ajit Thyagarajan IP multicast support 35.Tomoaki TSURUOKA TRAK clock driver 36.Paul A Vixie TrueTime GPS driver, generic TrueTime clock driver 37.Ulrich Windl corrected and validated HTML documents according to the HTML DTD ELF4P4 (10444`&`&`&s&s&000Z\}\}\} GNU!^\NW!hRD(9D2Eo?x)gb2r!W]>nh=z[SAb8y)>BOJ^%$X`U_bx@1#7z\d{t<Zw SZ<Wf_ h 6e]ea"by')=TB(,RJ}6x+5OHY'za`<EfjDX NpZ 8g!)i  y|o^;YoKB5Qu iqpG GsMKW0Z=$?TG1T8,EAU-sO|&DS T!b-4BYBFcL{ 9[<vxwPd1o`U}N ldv2@Xpq9`0vVySI$n6]E #^ N PH^rOJcWhx_~}i+sCH A|@wnc|dramV8*\LY- AP!Cg0ca'P&gIG{@+-K0YEn,6uA^~_tyHQMoaZ[E':>V4Via I 4;fl5z^x`eBX4 ?-5DHa8YMWn:0mZJ/JwF(FNpO }g~dqiQ[LyL8HHk{_ :}+-RSY< V#{|cj_zp4h|KZ`j09t=lGsRsm'&un3tFeu  ID9!Sy3>O27 S7(m~&w cFd@dtpo*h%5}`]v\_3QeE.[>oy<vkGnZ f UP(Ri:+;'1v*X0"C?>9{rK*RQ5,.W;IYC1,Frm{:A7C-e1M%$P"E.nd+jQO"vm7Mq6]l@6owsr uTGt<h}q$|#?U  X=Mub"4l~&HcK7>T]l~qL#9DC%A[TuB8}k*6qMi Nc(pkPMkRIIKh*t " )$|wGr~f Xg<j\);Qf1/jfQ bL,U:=::"647 7~k=f\C'kz;g/3Jb?A^]l,]3v%R;?$\&V/qsp. /J54F#X La)i  FS{; N L2?Wew@tm/ [.*jr3el=KVN&/U.CDT3\}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|%j8(UzJB[_O.I#xVug95 P>mx%`2@zs2+ kx1LpH` p  `  `&0`b@cDcHc\}4~@~H~ !"#$%&'()*+,-./0123;6 D\" M S -ВV" ]ܖ * l? $NA" t, +" V   R   Խ'  < @ x @( 0: h3"  1   7  G $hJ  6 * 8} J A s V\f g a(6 r` Ի" [!_] @)"  " dT  ", % TEi" & GD ' @L" 2 8 `; c.} VC =Z!n@* P0G; (" P 7 K hF&   k P&  7 /" @ ="   v"  " - 0 7   J!f# Qw-" 5 ,@  g  X8[ r#  |L O Ѝ"  ?" (K[  /  f  & I9" _ F   ` u"  /    |0  q 3/ 3C " 4; 0$T`0" <d" 7 I @ , I ; O 2 ]X pQ(" X\!ܶ` wtl 9!Ђ4 :  4" #  ."   E 8 B" $  /H G  :/_ SD2 KN ]  {@D3 f "  G :" M :" T7 ' 8  `0   /"  e# xF   ,0C] 08(  M! B d(C O 2 QJ9" i [Pr tN   LT`; "  *  g" ,& ?F 0kK ! 4/ p$ " !EN  )= 2 " 3?3Z" : u" U J _ 1 -= f3 oh" `"  7 % r K | 7(%" @`L  9 $<1 ` " 3 1 "`) ?* Tb J  D3*" \ H d@  "  ? w - 3,*   ;"  ; |k6" N "  ;" t ?  " ВV" \  D(" 2   T 8m ; 5 I 0N O 5  ~:@\ & a x9 O n _!w (  ̜( ? L A8 @ 3 =" K < >" A  88 5  5 ' 9a #C4" 1 E ` - ` 7" N hkd =p( " a Ќs" g Pw - y 0 _0G ) < (  - _ C  ka p+  . * ." ! , u" 1  " I P2 ;" P l M |  P/ w" df N  0  ج("  u" A* e xu& Y 0 = EE  ȭ(" (    4 Н R @ , u" @;#&" x  I ` % U  7" Dx j  : a , w" S PY]  x  p `f  B  e      -" " " 4&  \& GI = UP2 C " V" X RI - h 0* T I71n" ` O  " `7y P_"  /" 1إ $" " df& `VN hU(" ! -@ 9dG B  L; ; _ DEy" SJ l $ e`G " \0 ; t(" =B`* m ?;`" Ļ+ 7  T Y (" xA. PE    8 7 08 2 0 u" V " &3 =" - " ;te S> n D R ] n, *  " vPK $  " dF 8 Z ̟  o" 8| ` I 7 o < 7" Lx  \ # ^ )[!8H {" pQ; D Lz =" V@" ]8 p VP| 8  &-s" +\/" @   q   ;" s# P  ` Q C `' Y a e# > 0 !m O4@X. 9tB E@< + | q K0T =" ^p Tp  g =L("  [ t  "  )S" LI @{  ; ,`  % :0; ;"   * I@@, 60 0 [ /1x" Q ( dtZ." \4 + n  p10 u" 0b 2tA2 p u" P  L\9"  H(" P/ p j ` W - u" |I ( 5U" >jK" 7 4 }" ܧ5 d& ЊH C``H" %(" , =г +5" KaKp] \2 =" c7 vpS 1" } 4    H(   / u" O\  -ВV" -=  " # P " PR  8C . =" $4* P4  /N0 MЏ" 7 7 D" ? JX(" DHx" R v _ E!y j0o   0q @ 7 h5  :" ^dܖ *" . ЫR Px& ( PR %' ;" 5 )P ! E 1  ; <f E P-0B! q s ВV " ("  P& #" F7" TZ." !0 7" @ KA.  " e Ь 2 tD) =" @* P[ ;"  O .G/ 'i " :0Y  B| Y Tȭ(" [ e \lPe ;" x/ T 7" ^F[ p"  7 ;   " DI v"  :" 9 I" p I s    " $ 0( ;" +O0 >@H " E" M* _ę n" |h  r0 s < E B!E"  = Ȣ 4jk `   >*.  @, .4B-  " 6\!K2 L B ~ dI " v:@M;" pw ) y3/ Xp m" \! # l< +   x 5 G," ,< = ̂ \" "` x ] F  03 = $8 < KT ; [p ;" ep N.t" | 9 sm С <8  = <a `" : o  n 7 Y"  l \:" |R n`65" h, )Lp>N  - 0d 2 #- < Q; Zt a\" m: O>4 =" wR 0I -" [ " \ D2 c.}  &"    7" C|  Ol" p 6" $[Z   10z" < V M04W 1N0" dԀ t G$` ;" ĕ2 @[" ). :"  g  G -"  < -$  (f."   \/" Kl" O" ( pdw $ " @0N" E  " Mo a1^ W@f# m`65" }X  \!w 1 .8 (" 0 J 2 ;" Q ),  "  $" HA,  "    7   F B p1 7 @L9 5 #ma ' Xxce R ; y 7 i ; K   ~`  & P- b 5 X(" T(" Б2 2< 7"  i j  e  k "P \  / ;5" C0 ; Y" M(" _ N T l<  vP |0 ;      7" . u" $  q  :" \_  . \K  " @2  b  $6[ 0@Y" 9@3 G  VW7 c< D nЌ; u2 P: i "  D  " \| 0  i 7 p " g4  (<  p ? B9 0# [! ;" Q % X & a @ p (9 O C" o _}  G" } 8+ Ș F" ` [" HE " 4" !q; = !t %" &! C"  ,!\b ;!E J!." V!8  e! > 1 p!p(" >Ow!<5 P/" !0 7 !x !7" !@ ! [ !` } !!x r<P0 " !P C !> J U" " "8 ," " /3 =" E" " ["`  g"  i z"x9 o" : " = " " "(" " R" "0" "p' " R \!"  C s" "/ ",- " 7 E`3* !> 7'P $ " UP#L" .#pp #7#p;" E#0 <#`. w" m# d#  T#$ " v#| p7 , K 0N" XI# v" # f # #L8m #l^ # $/ # " #$N= $  0G/" ,$` : 11$85 o >$] E$` ; " O$ [$$R l$5" s$$Y $ 8 $ v" $  $ " zO  $* l ~%. $X!  " $ ;" $NA $ R \'P 9 $ = $P < %[ ; %p " % " ?%H0%@X e%H[ M%h#  =" v%0zg" %Щ L % :" < 7" %L" LA* % " % %  %+ %' ; %p %{ % " & & &ШY &p M (&/" -&- : A&  6&` : W&=J&h7 o o&`" e& q &n z&_5" &-s &P C" &P 7" & " &h7 .4 &4& (" &p  '-Z-" &0O & '@0L ' O 2 B! " 'L- %'83( 6'@ 4 >'Dt" G'< V S'0Q<" A[' 9 d' 7 r'$(" k'\z'" '  '$ '6 o J" '"x '@F& 'l '0  ( 7" (@0(P %( T+(L U" C &"  k" 9(  1( = A(4 " L( m(@ _(3 4 (`  (1 7" (h  ( N ()S (PNA H@4* (% (c ~62 ( (EX (,$ ) O&)? 9 -)2)$ " >)\y@ \!XW7" O D t I)D Q)L b)" 0kK" )`= p)- r )a\ )`7> )& )t ) )+ 3 )e ))" )5 *| )7 ;" tN" *0" * " 3$*t 6* `" Q*p# D*( f" <3 =" Y*  _*\Ia" h*@ t*PC  }*4 *pE  *P< - *  N " &*LM 1F :" *H8 n *0 K2 i" *&  *  *<; *A, +l +e 1 +\/ 4+6 (+C <+P 4 V+`3*" I+ I g+2 b+\\ w+1~ +0L\ +B +l +З" + +#& +5 + 2 + " + ? , ; ,0 ; $%,  " ,  >`+ &" 6,B V,4 2 s,pE b, !" N $ {,  ,3 ,B ,@7 , ,pT 7" (" ,` ;" 6!` / ,}1 ,5 ,OP ,\! EO[" -  II :" -a #-@Z1  7" 0- & l pL 7-P  (Bg " R-m [- h c-`B x- ; k-n <~R" -x " <" -ВV -{" -1 V -5 o - -6 n -H -p3P -4<.H .^3". : ..f 6.0 @.e" L.t ! U.hP@  > _! g. " y.M| .@" 0, a" .o . .  .>  N3 V" ./ .F .7n 5@@L . = . : .R /#S .8 ( A 7" /А  $/ 5/D @/, c I/s"  U/  s/" i /" /07 6* /h`." /C /` . %8 ?" /p / /?, .&) :   /`P[ /H O/(" /d / 06| 0 G / " 0`  0  ?0:r O0G\0 / i0 P " p0) x0 0  0P! 0MV 0l 0p ; 0L >" y -" 0\) 0, a 0 &1pE 1إ $ 1P  0p " -1x 71 j" D1 B T1  o1 j 1ܮP v1XP " 1 &" 1 U 1PEN  B" O KB* .J }" 1`  1$ -p3P" 1P3 7 1P " 1  1 " OLN2C 1 M 2 A '2 7 2M ,2!$ r#  A2l(" J2  ]2 dCP$g" U2؜ " y2@: 2( 20<2S ;" %[ ;" 2@  2@ 2" D > 2K 2 2L6 " 2< 7 2 2б / 2 " 32 = 3I 3|8 + *3@ t,LE U3> <3  k3h( ^3| B % Au3 V 3ЙH |3T."  $  3 0 +e - 3H" 37  3PB 3,.   7 _" 3TC 3p`" 3P  35 ["  49  "4 @r  *4X4 o 74p^ ?4 !" N4>" X4" P0Gb4D 8 K1 " m4jB v4`  4q" ." 4] f(3 4" 4pp 4  4b 4 " 5p n 4  5@ /" #5 " 5  -5 1 ;5 w B5P  Y5| " aFZ A q5 _ a5  : ~5 W" 5H 5  5  5P " 508 D1 > 5 5U 5(A 6l@, 6 '6`= 6* 56 'P " K6M" C6 ; X6`- g60 N 4 8 z62 l68 o C6P  G * 6D+ 6?* 6 (" 6 b9 6 6[ 6" 6z ;" 6X '" 7p O4 A*" 7" w 7@, 7` O H?#7/ +7D& ,  57Xd G71n" Fs" Q7 sR  ]74 1 n74 G 70; V x7 7,g 7 " 7 i" 73 74 =" 7)} < I" 7P% 7T 8  %" 8p 7 8!1 E#8 ? /8P " E8 9 ;8*% J8  `8K Q8` : o8%8 v8B. ; " ;N ;ܦ, i  <(T27 6 <p 7" <Hf" <J )<0 " 0<`  7< % ?<$- (4K< L [  " U<4 o b<l0 j<  " q<1 " %:  F" |< <@ <d & < OT<p`" D" <a" 8 l" <V" <EM <" <(" <t =`B" <t =L( = ) " = (" VD2 y (" )= 5= / A= <" T= b= ; r=l . w=@X =p ;" @p@ =P 2a =@$u- =? 9" =   =  ,5" =B=P, <  7" P&  C!x9" >V eE 2 CdK" >k '>  >./ =>lf $ = H>4 = T;  U>  <" a>l o>c >xx1 z>F >{ 8 > j" >ȅR >{  > Xp" >h ]Om >x H >jK >pX ?$\? = ? :" 0< O "?ȁ 1?3Z 3)  @ x" K@  ;? " ̌+ Z? " p?i v?@0 w" E?` :" 2 q ehD  ?5 W ?T8 (" ?D b ?d ) ?0 "" 0l? :" ?4OV ?  ? & ?`G @ +" # @ @?  #@p]" 3@P " <@ 9 C@V." N@@J" X@ h@{*" w@ \@ :|  @ @Q7 @@-" @K @ @  @L = @ J A@,  )= t$O8 JNN" A` 9 $A { .AB " :A0 JAP3 7" RA C [Ap{ Y D0 bA sA0}8 9P4 ;" A$ AzA  A  A 7 A 7 Ahr A R B ( BEM 8Bp4L +B0d p10 DB`* OB  UBX\%" lB0 ) " 8~B؁o ?%HB W B, ]" B4  EXlC E - E E- Ep F  F " F+0 *F : p !=@3 GF9F@e  D ZF 7" _!` qF& fFL W vF?* ~Fz  F 0 F| F~S Fs _ O F " Tp ; FHi" F  F|k6 F " FLv F, = #G G " 5GF /G94 GG$ OGy ^GT  8(" tG&" iG {G C p 6 Gx+/ G3" G@, e 1@ y+1~" 5P  G(8 + G< G wp z6\ GP ; G : Gc G  G\   " G Gp " uh H`5  i" H[k" H 42 =" #H 7 G0  3) 2 +H\!CH7V PHp   l" -A2 oHk P4A/ yH3 = H,( H< b H5 " C  H& H4  H6 } H: Hl S H| H  Hv" H`?# H<, I(" I\b" I`4 'I( y" D@^Q" /I8C ;I /" BI : "K0@ PI0Z "  eIp>8 wIP$g ~I0HU" IDh I<I` I   I,R " I^m  7" Ix  I= I " J, m" J` /" J|  ,J } #J  3J % ;J =" Iy DJp ; YJ & KJfJ  ( B J(J` JP |" J`+ & 8L" (L05b FL3 4" ?Lp "   7" V! kL,0 _L sL' F  /s L . 5< D L L, " LD y L J" L} L L I LW L2 ;" 6M(<+M" MT" M,' FM, N MMn \M= 1 fM" nMp" vMȃ6 )` x" M0s" 9P3 7" M   M 7 Mp & M : M " Mh  $  M0 MK" N [!NP  %-@Z1" N p 'N̅ 0N  EXlC HNN RNSbN\rN |N9 N , Np f P> Y N& N0 2@" NP4 N@) Nl q N + Njc NpC NDn D" N3 V O  Om ,O" ` O  8O b UO" IO  : qO2" N3 z yO " __register_frame_info_bases__deregister_frame_info_basesgetwcharseed48_rxdr_cryptkeyres__libc_tcdrainputchar__libc_internal_tsd_settsearch__morecorein6addr_anyntp_gettimesetgrent_IO_remove_marker__libc_sigaction__isnanl__libc_preadputwwcstoimaxqgcvtchrootstrcpyasctime_IO_wdefault_xsgetn_dl_vsym__sysctl_IO_link_in__daylightrcmdsetrlimit64_Unwind_Find_FDE__malloc_hookunsetenvh_nerr_dl_debug_printfauthunix_creategsignalpthread_attr_init_IO_sputbackc_IO_default_finishmkstemp64xdr_longlong_tbcmp_dl_check_map_versionsgetgrgid_r__malloc_initialize_hook__isxdigit_llocaleconv__default_morecorexdrrec_create__libc_fsyncfdetachxprt_register__divdi3__lxstat64clnt_broadcastioctlpthread_cond_signalwritevget_kernel_syms_IO_setbuffersiginterruptpututxlineputspent__pthread_mutexattr_destroyvscanfif_indextonamegetservent__xstat64getdirentries64ldexpf__nss_hosts_lookupmunlockall_IO_wdoallocbufgetutidposix_fadvise64getgidwcstok__getpidgetloadavg_IO_fread_IO_list_lockgetgrnam_r__strtod_internalstdout__selectsetfsentutimeversionsort64svcudp_enablecachewcstof_IO_file_xsputn_IO_default_doallocategetdtablesizelrand48_r__fsetlocking_obstack_memory_usedcfgetospeed__strtoull_lxdr_netnamestr_sys_errlist_dl_nloadedvswprintfsethostentsetservent__ivaliduserreaddir64_risastreamgetloginpthread_attr_destroy_IO_least_wmarker_IO_fdopen__register_frame_IO_popenlockf64_IO_vsprintfreaddir64getutxline__strtoull_internalsvcerr_authtcgetsid_IO_proc_close__iscntrl_l__pthread_once_dl_lookup_versioned_symbol_skipgetutline_IO_seekwmark_IO_fflushgetaliasbyname_rgetrpcbynumber_r_IO_wfile_jumpssigemptyset__pthread_mutex_lockgnu_get_libc_version__fbufsizeutimes__sigdelset_IO_ferrorputwchar_unlockedfpathconfputpmsgsvc_exitmemrchrgeteuid_dl_profile_outputinet_ptonmsgctl__mbrlenmalloc_get_stateargz_add_sep__sched_get_priority_max_IO_proc_openkey_secretkey_is_setgetaliasent_r__xpg_basenamehsearch__ctype32_b__rcmd_errstr__strpbrk_c2pthread_exitauthdes_getucredgetopt_long__fpendingendnetentsigholdsyscall_IO_default_xsgetn__endmntent__strtok_rpmap_setmunmap__sched_getparam__libc_stack_endfileno_unlockedulckpwdffts_setgetdate_rgetttyentwcstoullrexecoptionsxdr_uint8_t__nss_hostname_digits_dotsftello64xdrmem_create__ffs__libc_fcntlatol__towupper_l_h_errno__isnanxdr_des_block_IO_file_init__internal_setnetgrent__gconv_cacheecb_crypt__writexdr_opaque_authposix_fallocate64malloc_statsendfsent_IO_sgetn__wcstold_internalruserpass_nl_domain_bindingsgetgrgidclnt_spcreateerrormodffre_syntax_optionsnrand48__ctype_bstrtoimaxargp_program_bug_addressgetprotobynumberauthunix_create_default__internal_getnetgrent_r_dl_initial_searchlistclnt_perrno_IO_file_seekiswcntrlwcslen__cyg_profile_func_exitfchmod__pthread_mutexattr_settype_IO_file_setbufputgrentiswpunctmtracesetfsuid__getmntent_r_dl_sysdep_startstrtoldgetegidisblanksetutxentsetlinebuf__rawmemchrsetprioritywcstollposix_spawn_file_actions_initfopencookiegetpriorityiswalpha__res_ninitpersonalityiswblank__libc_accept__pthread_key_create_IO_init_markermemmem_IO_file_finish__strtol_internalgetresuidbsearchsigrelse__monstartupusleep_IO_file_close_itgethostent_rwmempcpy__tzname__woverflowgetnetname_IO_stdout_getprotobyname_IO_2_1_stdout___libc_current_sigrtmax__wcstoull_internalsemgetpthread_condattr_init__libc_pwrite64xdr_int16_targz_insert__pthread_rwlock_wrlockerand48_rupdwtmpx_IO_wfile_setbuf__strtold_lxdr_u_hyper_IO_fgetposenvz_gethsearch_r__dup2endaliasentqsortfchownwcsrchrsetstate_rkey_decryptsession_IO_flush_all_linebufferedglob64__wcstod_lvwprintfgetnetentgetspnam_r__strtoll_internal__gconv_modules_dbiswxdigit_IO_wdo_write__getdelim__readerror_at_lineenvz_addgetnetbyaddr_rfgetspent__pthread_atforkhcreatekey_setsecretgetpw__fxstat64_IO_funlockfilekey_get_convinet_nsap_addr_dl_initfgetws_unlockedprctl__iswspace_lfchdir_dl_platformlen_IO_switch_to_wget_modemsgrcvshmat__realloc_hookre_search_2tmpfilesetitimerwcswcs_IO_default_xsputn_IO_stderr_getpwuid_rpmap_getportexeclseekdir_IO_fwritesched_rr_get_intervalpclose_IO_sungetc_sys_nerrisfdtype__tolower_lglobgetutxidsvc_sendreply_rpc_dtablesizekey_encryptsessionswab__isblank_lcreatreadlinksetrlimittr_break__stpcpy_small_dl_debug_mask_IO_wfile_overflow__libc_memalignpthread_equal__fwritablegetnetgrent__cxa_finalize__libc_nanosleep__overflow__pthread_mutex_init_IO_fopen__libc_current_sigrtminustat__wcstoll_internalislowersockatmarktcflushdngettextexecle_IO_flockfile__fpurgegetpassgetuidargz_addtcsendbreakrewinddir__isinfiswlower__strsep_2cdrand48_rhasmntoptfgetws__rpc_thread_svc_max_pollfdwcspbrk_IO_file_closewcstol_obstack_begin_1svcraw_create_nl_msg_cat_cntr__open_IO_unsave_markersisattyposix_spawncfgetispeedconfstr__dgettextiswspace_dl_lookup_symbol_skipendpwentsvctcp_createpthread_attr_getscope_IO_2_1_stdin_optarg__isprint_l__strerror_r__asprintf__bzerosysinfoloc2ldexpstrtollxdr_unixcrediconv_openauthdes_create__strtouq_internalgethostbyname2_rxdr_keystatusopen_memstream_dl_lookup_versioned_symbolh_errlistsvcerr_decodexdr_bytes_dl_mcount_wrapperstrtoumaxxdr_int64_tfexecvewcsncmppivot_rootgetutmpx__pthread_rwlock_rdlock__chown_dl_profilexdrrec_endofrecord__libc_longjmpstrtoul__dso_handlesprofilgetutent__wcstoul_lwcsstrreaddir_rendutxentmktemp_IO_switch_to_main_wget_areaispunctgethostbyaddrsettimeofdaywctomb__dcgettextmemfrob_obstack_newchunkwcstoq_IO_ftellopterrclnt_create_IO_str_init_readonlysigaltstackrmdir__adjtimexwcstombssgetspent_rscalblnsocketinit_module__frame_state_for_pthread_cleanup_pop_restore__finitefreaddirfstatfs__flbf_IO_adjust_wcolumnlchownwcpncpyauthdes_pk_createre_matchsetgroupspmap_rmtcall__on_exit__strtoul_internal_IO_str_seekoffdelete_module_IO_file_seekoffclnt_perrorgetrpcent_rclearerr_unlockederror_message_countisspacepthread_attr_getinheritschedvwscanf___brk_addrhcreate_r__pthread_rwlock_unlockfgetspent_rfts_open_IO_printf__libc_mallinfo_dl_global_scope_allocgetdate_errxdr_voidcreat64__bsd_getpgrpxdr_keybufbind_textdomain_codeset__ctype_toupperargp_errorposix_madvise__libc_pwrite__libc_readgetrpcbyname_rgetservbyport_rftruncateether_ntohostxdr_pmapstty_IO_file_syncsvcerr_progversnfsservctlssignal__wctrans_l__cloneglob_pattern_pfgetgrentrealpathsvcerr_noproc__strcspn_c1__pthread_kill_other_threads_npgetrpcbynamealphasort64__pthread_initializembstowcsputenvargz_create__umoddi3__libc_reallocwmemcpy__nl_langinfo_lclearenv__environposix_spawnattr_getpgroup__waitmmapvswscanfgetsecretkeystrncasecmp_Exitxdr_vectorobstack_exit_failuresvc_getreq_commonwcsnrtombsxdr_rmtcall_argsrexec_afgetprotoent_r__mempcpy_small__freadable__udivdi3posix_openptgetdomainnamesvc_getreqsvcunixfd_createfreeaddrinfoabortgetptendprotoent__wcstoull_lgetutline_rxprt_unregisternrand48_renvz_entrypthread_attr_getschedpolicyffslwcscoll_dl_closeutmpxname__newlocalefgetwc_unlocked__printf_fpnftw64__libc_enable_secureseed48getnameinfosrandom_risxdigittdelete__getpgid_IO_fputserror_print_prognameposix_spawnattr_getschedparamxdr_charclnt_pcreateerror__freading_IO_str_pbackfailmlock_IO_wfile_xsputngethostbyname_racctxdecrypt__nss_next_IO_file_overflowsstk__wcscasecmp_l__freelocalestrtoqstrtol__sigsetjmp__libc_lseek64xdr_rmtcallresether_hostton__backtrace_symbols_fdvlimit_dl_lookup_symbolstrnlengetrlimitwcstodxdr_doublegetnetbyaddr__signbitmblencapgetposix_spawnattr_init__lxstatunameiswprint__wcsxfrm_lverrx__libc_allocate_rtsiga64lpthread_getschedparam__register_frame_tablecfsetispeed_IO_fgetpos64xdr_int32_tutmpname_IO_fsetpos64__libc_pread64__strcasestrhdestroy_rrenamegetservent_r__iswctype_l__sigaddsetxdr_callmsg_IO_iter_beginpthread_setcancelstatexdr_union__wcstoul_internalsetttyentmbsnrtowcs__sysv_signalstrrchrmprobewaitid__after_morecore_hook__libc_internal_tsd_getwcscpyxdr_enum_obstack_begin__towlower_lcuseridmodflxdr_bool_IO_file_statre_set_registershost2netnamemoncontrol__pthread_mutex_unlockmalloc_usable_sizeimaxabs__modify_ldt__strtold_internaltdestroywait4_IO_wfile_sync__libc_pvalloc__strtoll_l_IO_file_fopeninet_lnaofstrtodxdr_wrapstringxdr_rejected_reply__sched_getschedulerrindex__strtok_r_1cinet_makeaddrgai_strerrorlocssetprotoentsendfile_IO_do_write__pthread_getspecificgetprotobyname_rpthread_condattr_destroypthread_attr_setscopegetrlimit64rcmd_afinet_netof__libc_vallociopermulimit__strtod_l__ctype_get_mb_cur_maxatof__backtrace__backtrace_symbolsxdr_freexdr_netobjfdatasync_IO_stdin_jrand48_r__key_encryptsession_pk_LOCALsigstackkilliswgraphfputs_unlockedargp_state_helpsetpwent__pthread_mutex_trylockkey_encryptsession_pkdl_iterate_phdr__nss_group_lookupxdr_int8_tsvc_registerxdr_longstrcatre_compile_patternargp_program_versionposix_spawnattr_setsigdefaultbind__iswcntrl_lrand_r__setpgidgetprotoentsvcerr_systemerrsigvecif_nameindexinet_addrreadvntohlqfcvt_dl_lazy__profile_frequency_dl_debug_state__strchr_gumount2xdr_cryptkeyarg__stpcpyqecvtmkfifo__gettimeofdayscalbnlpthread_cond_broadcastif_nametoindexsys_sigabbrev__deregister_frame_info_IO_str_overflowobstack_vprintfreboot__sendsigwaitinfopthread_attr_setinheritsched__finiteinitgroups__memset_cg__statfspmap_unsetfseekosetregid_dl_argvposix_fadviseshmdtsigignoremodffstatvfssetsockoptendgrent__iswpunct_l__fpu_controlxdr_shortbsd_signalargz_extractfseekmremap_IO_setvbufvm86pthread_setschedparamctermid_nl_current_LC_CTYPEwait3__libc_sa_lentmpnam_rsvc_getreqsetnl_langinfoshmgetgetaliasbynameprintf_size_infoqfcvt_rsetstatecfsetospeedmemccpyfchflagsuseliboptindwcstoldgnu_get_libc_releaseposix_spawnattr_setschedparam__iswgraph_l_IO_padn_IO_getline_infofattachsvc_getreq_poll_nss_files_parse_pwentswapoff_res_hconf__open_catalogstdintfindmincorefnmatchre_match_2xdr_accepted_reply__libc_open64_IO_str_init_staticumaskscandir__strcoll_l_dl_dst_substitutelfind_IO_putsffsllsvcerr_weakauthxdr_authunix_parmssvcfd_createinnetgr_IO_file_underflow__pthread_mutex_destroymktime_resfgetpwent_r__prognamecatgetsmcheck_check_all_IO_flush_all__wcsncasecmp_lstrstrunlockptgetwchar_unlockedxdr_u_longlong_t_IO_iter_filertime_IO_adjust_columngetutxentloc1xdr_uint64_tcopysignlflockftellomalloc_set_statesetgid__libc_init_first__strchrnul_cargp_failurepsignaldirfdendutent__memset_ggsetspent__memset_ccgetspnamget_current_dir_nameopenlogxdr_u_char__iswupper_lin6addr_loopbackstrcollclntudp_createcloselogisupperkey_decryptsession_pknftw__argz_count__toupper_lstrncmpposix_spawnpquery_module_IO_fprintfl64a__secure_getenv__strverscmp_IO_wdefault_doallocatesigorset__isalpha_lgetpublickeywcsrtombs__pread64alphasort__libc_malloc_IO_getsgetusershellsethostname__cmsg_nxthdrgetdents64_IO_ftrylockfile__isdigit_l_dl_main_searchlistversionsortget_avphys_pageswmemsetwordexp__internal_endnetgrent_IO_marker_delta__libc_freestrncpyunlinkgetrusage__strpbrk_c3freopen64_IO_sungetwcprogram_invocation_short_namehtonlxdr_u_long__dcngettextrevokeposix_spawnattr_getsigmask_dl_openwcwidthisasciixdr_replymsggetnetbyname_raddmntent__libc_siglongjmpfcloseall__iswdigit_ltowupperkey_gendesgetrpcent__iswlower_l__strdup__ctype32_toupper__cxa_atexitargp_err_exit_status__libc_sendgetutmptmpfile64makecontext__isnanf_IO_wmarker_deltapthread_cond_initbcopywcsnlen__libc_mallopt_IO_getcremquestrtok_IO_ungetcsigfillsetxdr_uint16_tlisten__sched_setschedulersvcerr_noprog__gmtime_r__libc_freeresposix_fallocatesvcudp_bufcreatexdr_opaquewordfreemalloc_trimposix_spawnattr_getsigdefaultswapcontext__wcstoll_lsigset__islower_lexecv__sched_yieldisalpha__strcasecmp_lwcscspnwcstoul_IO_file_write_IO_marker_differencesetresuidvtimesstrncatexeclpposix_spawn_file_actions_adddup2fputws_unlocked_sys_siglist__libc_pausemsgsndlcong48__pthread_mutexattr_initclntunix_createwcschr_IO_free_wbackup_areaxdr_callhdrsetdomainnamere_compsrand48__res_initgetrpcportgetprotobynumber_r__poll__getpagesizekillpg__mbrtowcgroup_membergethostbyaddr_rposix_spawnattr_setsigmaskualarmttyname_r_IO_free_backup_areasigreturninet_networkgetpmsggetlogin_r_itoa_lower_digits__libc_close__underflowscalbnfinet_atongetfsent__isgraph_lgetdateether_ntoa_riopl_obstack_allocated_pstrtoullendhostentregcomp_pthread_cleanup_push_defermrand48_r__sigismember__ctype32_tolowersymlinkttyslot__sigsuspendsetcontextgetaliasentasctime_rwcsncat__pipesetreuidgetopt__libc_open_IO_wdefault_xsputnlocaltime_IO_default_uflow__cyg_profile_func_enterputwcharnetname2hostwcstoumaxsemctl__strtol_liconv_close_dl_origin_path_dl_start_profilecfmakerawsiggetmasklockfiruserok_afwcsspn__ispunct_lsrandsethostid__rpc_thread_svc_pollfd__wctype_lstrxfrm__iswalpha_lstrfmonget_phys_pagesvfwprintfmbsrtowcsgetpwnam_rclearerrposix_spawn_file_actions_addopeninitstategrantpt_dl_clktckgetcharxdr_stringposix_spawnattr_getflags_dl_relocate_objectntohsinet_ntoafgetpwentgetppiduser2netnametcgetattrgetservbyportptrace__nss_configure_lookupregexec__libc_recvfromendusershellopendir__wunderflowgetnetent_rgetgroups__uflowxdrstdio_create__register_frame_info_table_bases__libc_system_dl_dst_countrresvport_afisgraphwcsncpy_IO_sscanf__assert_fail__strchrnul_gbdflushsigtimedwaitgetrpcbynumberftok__iswxdigit_l_IO_fclosegetgrouplist_IO_switch_to_wbackup_areaisalnumptsname__wcstof_l_IO_list_resetlock__signbitlwcschrnulhdestroygetitimertmpnam__xmknodseteuidisprintmrand48xdr_u_intxdrrec_skiprecord__vsscanf__strxfrm_lgetopt_long_onlyendttyentxdr_pmaplist__towctrans_lpthread_attr_getdetachstateenvz_stripllseek__lseek__strcspn_c2_nl_default_dirnameendrpcent__xpg_sigpauseinet_nsap_ntoanice_IO_getline__setmntentfgetgrent_rrresvportgttyherror__libc_recvmsgfread_unlockedstrcmp_IO_wdefault_uflow__check_rhosts_fileargp_usageshutdownargp_helpnetname2usercallrpc_seterr_reply__rpc_thread_svc_fdsetpmap_getmapslrand48obstack_alloc_failed_handlerttynameregister_printf_functiongetpwuid__h_errno_locationposix_spawn_file_actions_addcloseswaponsigblockcopysigngetcwdeuidaccess__res_stategethostbynamestrsignalgetpwnam_dl_starting_up__deregister_frame_IO_setbendspentauthnone_create__vforkcopysignf__strspn_c1getservbynamefgetcgethostnamevwarnether_aton_r__mempcpy_dl_unload_cacheclnttcp_create_obstackdifftime_IO_wfile_seekoff__iswalnum_lgetcontextinsque_IO_wfile_underflowstrtof__toascii_lpselect__libc_waitpidtoascii_IO_file_doallocate_IO_fgetsstrcspn_libc_intl_domainname__iswprint_lqecvt_r__rpc_thread_destroyxdr_key_netstres_IO_init_wmarkersetlocalegetpeernamegetsuboptiswdigitcfsetspeedregerrorkey_setnet_IO_file_readstderrumountpututlinesetaliasentmmap64shmctlmkstemp__strspn_c2getttynam__iswblank_lerand48scalbnfstatvfs64setrpcentsetlogmaskiconv_IO_file_jumpssrandom_dl_out_of_memoryargz_replaceputmsgstrsepcfree__strtof_lxdr_sizeofmuntrace__isascii_l__isinfffstatfs64__waitpid_IO_fsetpos__libc_forkre_compile_fastmapxdr_referencegetservbyname_rverrputchar_unlockedsched_setparamregisterrpctimelocal__wcstof_internalcbc_cryptposix_spawnattr_setpgroup__key_gendes_LOCALprintf_size__strsep_gfputc_dl_mcountiruserok__nss_database_lookupenvz_merge__libc_lseek__wcscoll_lfeof_unlockedxdrrec_eof_IO_wdefault_finish_dl_mcount_wrapper_checksteptimegmfts_read__strsep_3c_IO_peekc_lockedclnt_sperror_mcleanup_IO_feofstrfryoptopt__connectgetchar_unlocked__strcpy_small__strnduppthread_self_dl_init_all_dirspthread_setcanceltypefwideiswuppergetsockoptglobfreehstrerrorlocaltime_rgetaddrinfore_set_syntaxsocketpairsetresgid_IO_sputbackwc__libc_waitfflush_unlockedtwalkxdr_authdes_credstrftimeargz_create_sepscalblnffputws__wcstol_lgetutid_rfwrite_unlockedobstack_printf__timezonewmemcmplldivwmemmove_IO_unsave_wmarkers_IO_wdefault_setbuf_IO_file_openposix_spawnattr_setflags__res_randomidgetdirentriesisdigit_dl_map_objectmkdtempgetmntent__isalnum_l_IO_list_unlock__closequotactldysizesvcauthdes_statsfmtmsgsetfsgidmallwatch_itoa_upper_digits__xstat_dl_load_lock__sched_get_priority_min__strtoq_internal_IO_switch_to_get_modepasswd2desgetmsgposix_spawn_file_actions_destroybindresvport_IO_vfscanfether_atonhtonscanonicalize_file_name__strtof_internalcatcloselsearchwcscasecmp_nl_current_LC_COLLATEstrptime__rpc_thread_createerrrewindre_max_failuresstrtouqmcheckfreopen_dl_fpu_control__wuflowre_searchfgetc_unlocked__sysconfinitstate_rtcgetpgrpdrand48if_freenameindex__sigactionsigandset__libc_calloc__argz_stringify__curbrklcong48_r__isinfl__wcstol_internalxdr_float_dl_loadedpthread_cond_wait_IO_doallocbuf__strncasecmp_l_dl_signal_error_flushlbfgethostentgetnetbynamewcsftimesvc_unregister__errno_location__strfmon_lget_nprocs_nss_files_parse_grent__argz_nextwcsdup__vsnprintf_obstack_free_dl_profile_mapsemop__free_hooktowlower__pthread_setspecific__strcasecmp__fxstatether_ntoa__strtoul_l_IO_sprintfllabsstimebindtextdomainklogctl_IO_wsetbrpmatchxencryptfrexpfinet_ntopfrexpliswalnumget_myaddressgetresgid_null_authgetgrnam_IO_vfprintf__assert_perror_failwcscmpxdr_pointergethostbyname2__pwrite64_IO_seekoff__libc_sendmsg_authenticateerror_one_per_linentp_adjtimeglobfree64atoiiscntrlfts_close_argp_unlock_xxxferror_unlockedcatopen_IO_putcpthread_cond_destroygetutent_rscandir64argp_parsefileno__moddi3vsyslogpthread_attr_setschedpolicyaddseverityrexec_IO_str_underflow_setjmpfgets_unlocked__signbitfendserventwcpcpy_IO_stdin_usedsvcunix_createwcscat_IO_seekposgmtimestrspnwctobmunlock__libc_recvtempnamdaemonvwarnx__libc_start_mainscalblnlstrlenargz_appendsigpendingvhangupprogram_invocation_namexdr_uint32_tposix_spawnattr_getschedpolicyxdr_array__libc_write__vfscanfxdr_cryptkeyarg2__fcntlatolldes_setparityclockxdr_getcredresgetw__strchr_cwcsxfrmvdprintf_IO_init__assert__wcstold_lptsname_r__duplocaleregfree__strsep_1c__fork__libc_sendtoupdwtmp_dl_all_dirs__wcstod_internalstrchrsetutent_IO_file_attach_IO_iter_end__gconv_alias_dbwcswidthxdr_authdes_verfargz_deleteether_lineexecvppthread_attr_setschedparamwcsncasecmpsetsid_dl_symputpwent__sbrksetegidmprotectcapsetrpc_createerrfts_childrenposix_spawnattr_setschedpolicyargp_program_version_hook_r_debug__sigpauseclosedir_IO_wdefault_pbackfail__libc_msync_nss_files_parse_spentsetnetentfgetwcvfwscanf_IO_list_allimaxdivadvancecreate_modulewcstouq__memcpy_csetusershellenvz_removevasprintfsvcudp_createpthread_attr_setdetachstatefputc_unlockedstrchrnulsvc_run__fwriting__isupper_l__key_decryptsession_pk_LOCALtzset__iswctype__strspn_c3_dl_addrmcheck_pedanticfputwc_unlockedldexplsetuid__open64_dl_catch_error_IO_un_linkjrand48__register_frame_info_tablegethostidget_nprocs_conffseeko64getwdre_execclntudp_bufcreatetcsetattr_IO_default_pbackfailmkdirsigisemptyset__register_frame_infoposix_memalignsigsetmask__ctype_tolowermsggetclntraw_createsgetspentsigwaitwcrtomb__strcspn_c3frexpmlockallparse_printf_formatsetlogin__libc_connectpthread_attr_getschedparam_IO_iter_next_dl_pagesizesrand48_rmbtowc__memalign_hooktelldirgetfsspecfmemopenposix_spawnattr_destroy__stpncpy_IO_2_1_stderr___progname_full__finitelstrpbrktcsetpgrpxdr_int__nss_passwd_lookupxdr_hyperfputwcraisegetfsfiletcflowclnt_sperrno_IO_seekmark__isspace_l__towctrans__gai_sigqueuexdr_u_short__res_nclosesigprocmaskxdr_key_netstarggetsocknamembsinit_dl_map_object_depsfopen64ftruncate64ld-linux.so.2libc.so.6GLIBC_2.0GLIBC_2.1GLIBC_2.1.1GLIBC_2.1.2GLIBC_2.1.3GLIBC_2.2GLIBC_2.2.1GLIBC_2.2.2GLIBC_2.2.3GLIBC_2.2.4GLIBC_2.2.5GCC_3.0                      eOii Oii $OOqi $OOri $OOsi $OOii $OOqi $OO ri $OO si $OO ti $PO ui $PP P&y PPOqi Osi Oii Oii Oii O00 00(0,080H0L0X0h0l0x00000000000001 11(1,181H1L1X1h1l1x1111111111111111111111111111111222 222220242H2L2`2d2x2|222222222223 3 3$3D3H3P3T3\3`3d3h3l3p3t3x3|3333333333333333333333333(4,4044484<4@4D4H4L4P4T4X4`4d4h4l4p4t4|444444444444444444455 55(5,50585<5@5P5T5X5\5`5d5h5l5p5t5|555555555555555555555566 666 6$6(6,6064686<6@6D6H6L6`66666666666666666666666777 77777 7$7(7,7074787<7@7D7H7L7P7T7t777777777777777888 88888 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8888888888888888888888888888888999 99999 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9|99999999999::: :::: :@:D:H:L:P:T:X:\:`:d:h:l:p::::::::::; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;;;;;;;;;;;<<< <<<<< <$<(<,<0<4<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<<<<<===============>>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?@PDUHVT\Xfdyhltx!'Ć+Ȇ-І>؆S܆du  ,0HLT(X*\7`>lTxyć̇ Ї؇+?@AHKPo  $,<PX\dtx |"6>NRoĈԈ܈} ,04<@DHPX\ptDEcfȉ؉܉=\$e(t,04<@DLX\`hlpt x|T~CX~H\~L`~Nd~Sh~Wl~Zp~[t~`x~l|~n~o~v~|~~~~~~~~~~~~~~~~~~~~~~~~~~~~~     $(,048<@$D/H0L2P9T?XF\J`MdPhRlSpXt[xc|egkluz}~  $( , 048<!@'D(H)L,P-T7X:\H`MdQhSlUpZtbxc|jlmouĀȀ̀ЀԀ؀܀   " &$.(3,6074889<<@DDFHGLKPOTPXS\W`_dehglhpmtoxu|vx{}āȁ́Ёԁ؁܁  $(,04 8<@DHLPT'X)\*`,d-h2l3pPtTxV|XZ[`bgiuz{|ĂȂ̂ЂԂ؂܂  $(,048< @ DHLPTX$\(`)d*h,l2p<t=x>|CGW]bfhimnor|ăȃ̃Ѓԃ؃܃  $(,048<#@1D7H9L>P?TBXI\O`SdXhYlZpatbxh|kxz{}ĄȄ̄ЄԄ؄܄  $(, 0 48<@DH!L#P)T/X1\2`8d>hAlCpGtOxa|cdfirząȅ̅Ѕԅ؅܅  $ (, hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhh h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhU WVS[ú8 E>t Ѓ>uSjEPWee[^_Í'U WVS[Z} u,(1t :%u# f9tPjU 8d 0VWRe[^_UÍvUS[U WVS[æ}uMU Dd U$ U tjjQ tjjV  t7x$P-}tEt7$P U2WE PUPvU WVS[}$ ; sWE PEPЃ; re[^_Ít&US[Ìh$Pj]ÉUS[_$[ÍvUS[C$[ÍvUS[$jUtS[juu[8 uQu 'Pƒt2EPRjuE%= u}u}t]US[thjVhjG hj5]US[/[ÍvU0WVu}EEU U܅uV9vEU1*}u 1ƋE܉ljU܋EEU}9UUE;}v'E1}EEU܉Uv4EuH9}w9urEM܋U)M܉UE1}EEU܉UE E)EM NjMU܋MMe܋EM E܋MeEEUE;Uw uE9Ev MM)M1}t5M܋E+EщM܉ʋMM ‰UEEEUMQEE}EU^_ÉU WVS[Zu} EUE}Eރ߅} U؃ڃjRPWV}t؃ڍe[^_ÐUWVS[u} UME}Eރ߅} UڃكEPQRWV}t ]U]EUe[^_ÉUS[xjEURPEU RP?]ÉUS[DEPEURPEU RP EU]Í&'UWVS[}u @<FAu[^_ÉU,WVS[ú}эA$)ĉe}EEE?tO H4Qu_t -t.u @</u E}t/FG?ut&/FEE~ExuEPEPEE} эA$)ĉe} E?tT H4Qu_t -t.u @<v/u E}t/FG?u /FEE~ExuE PEPUEE jMU E tHw Ee[^_Í'UWVS[} E}tEEt7uM}tU:uEPjj11ҋEtSEPEMPEP11ҋEP/U EPUUPRE(‹)M)}t M+EM)+v EhTETt&{E+UB$)ĉR}WPEэA$)ĉQVPE̍UUօuE@8,t1ɀ8tAt @,u@M̅Q VZ(PMQurEEЅt' 9Ptt&E@t 9Pu1󫍻|$D$  D$}EVl(PURuMaEuuvt%t PMQu)v}̉<$}ueE`U:,uB:,t1:tЍP t B,uBME̅j/}Wt:j/@P}t'@8t!)P)ԉPWREuEPMUEE؃1uЅt*>t nuFtGEЋvuփEPEu EEUBEփEPjVEuM;MEuE} }MEULuЅ&1;~ EEȃ F4EUt E~tEMtEPFЃufjFFAFAEA AU }E|8(tt&Pxu G;~ Gv+EH9ErE M}Dg}ԋUM|EUt,+t,V6M}LUD E$E$E8E$E܋U;U}Eă}EM܅t~MMM}܍E( u We[^_U WVS[uEE;F s>1F|8~$D8tPFRD8Ѓ 8EE;F răFp F +F Fpg vYVPe[^_UVS[3ƋFPVu-FtP$VFЃ t se[^U,WVS[EMEEǃt Euu)PmEEEUE }JU)MME܉΍v}uEPGF U܉UE@M ;u7 U܋MDDUMDFF4G@8/uZp…t|FB FJNBFt=QEPFЉE tEMF'UUEEȃȃEM}t`EMU ; s&)ȋU4‰8EEM ;rURM E}u'EMU E UEe[^_U,WVS[úE׉}EO})EuEuEUDE@MD }|FtS(o‰u4NE8G;}suu8G;}rEQ&B FBFBFUBtP MQAЃ EȃȃEOLEe[^_ÍvUMЋQ4DJ u(}Ѝt&G<F>_W4DJ t߀>GFuȉu䋃 @4DP t&FDB u>  t&A<F}ȈG}Ȁ>A4DP tڀ>E@Eȍ&F P4EDJ uUȉUt-}ȈFG}ȊtEċUЋB4}Dx tt&E@E+t&UBUȍEjj PVE؃;utEM&tMԋA4DP tE+EmU䍻.RuMԋQ4DB t FDB uu܉u>i}G<FUBU>K W4DJ tҀ>-MAMFu؋ @4DP t!FDB uA<FUBU>t A4DP t؋M9MAME}+}܍GP3ƃFWURPսM)ME؉F V* t90tRVDu?E䍻.u(| | E PURMUEpMuQj EPEPgǃuuVie[^_vU,WVS[fHt􍃀 P/ Ex>uM)װэA$)ĉQRP蕼EEEEt&эQy}A$)ĉej)PR6uWf.fEf.f E.. :.. . . Š.E늃.E݊.E}+;v':Aef:A[f:UQAK1AD&1E݈AA0v1UfQA1EfAUQA1QAP-jj> EǰIM1j:u¾E@Et#G9tF׃j:GP…u߃}TFERĻE7L1 EUUuv@8:t18tƍFt @:u@Eu.Ph.P!/PE >/t?}u.Ph.P5/PXUREPQ/AVQy/t/AȋU+D ;vAGE8:u@8:t18tƍFt @:u@UIED Eu }tUR t􍃀 P-e[^_ÐULWVS[NEEƋE0Qu U_ >uEM̍UUȍ@M8tq UЉUM|G$)ĉej')PWREP^PUEPEPUEEU<uEuM̋E EPE& UBUąM̍<1E܃8U܋267u}t&NM܋v67u܃vwuDžtUWF9| uNF 9G }FFGFGFGE܉8V!VU܅}u܋M܃9OE܉8UĉU E$vMMEװэA$)ĉQRP貶Ƌ @4DP t FDB uuԉut&G<FU؈BU؀> W4DJ tҀ>MAMFuЋ @4DP t(FDB uvA<FU؈BU؀>t A4DP t؋M9MtyAM؋Euf}+}ԍGPƃtKFWURP衵M)MEЉF V" t90t V}}hUe[^_ÍvUS[ä t 9t R]ÐUWVS[jEEгEƍt&6MQ2t E} v߃} v,0PjEF0PX0PE@MD GGGGD G D G$D G(D G,G0e[^_Ít&UEEU)E+E9~Ѕ}$ 8U PWuVEMU9 u EE;EvEu܉u}E p t2Ft$PuURM1Wv FЃ0vu΋u F F*}9}vgEEPѼU$RjMQjuEPuV}WU҃0tMU9t)ʋM)Ev}uEu E}u } E}$tr}ulEE)Ѓ~-81Ph0P0P.EU41;Usu F}TAE9ru V$ ȉEe[^_ÐULWVS[þu E8EU $UEM Au@Ets}tx1Ph.0P0P{1U B@B%MQPE$PVURjjjMQuVU҉}uM uEE @EEE}tUU؍MM̃}$u N}tx1Ph0P0P请}̋U RUȉ‹u;Es"w4D EBu;Esvw$ Љ'yvEȨu&!EU EMvvu6uEE܋U RUԋM)U)9~ʅ}19s4UԃUЋ}}t7}t1U t&A9rՋM1ủU9ut&;Ev׃}M q t5Ft'PXuEPU2MQv FЃ0vuˋu F FE9Ev]EUR M$QjuVjuEPEPURMу0tMU9t)ʋu)u 1U Eu M E}$tpukuE)Ѓ~+x1Ph0P0Ptt&EU/1;Usu FuTAE9ru V$ ȉe[^_ÐU;EOMIx$? x>xusE}tjE p t&vt96菬UREPMQEPE0v U RMQЉE0t}u}tt uEE;EtN+EU ʃ9y2Ph1P2P )ЋuEEEEh}ubE9Euy2Ph1P?2P轨E+EM)ЋuE;EsUMDEAME;Er}t Eu EUt&M MuuE @EEMuʋu9OMϋE9oЃ9+w E|Džxt( t&xxw uድx>;EMIx$? x>xusE}E p vvt96OUREPMQEPE0v U RMQЉE0t}u}t4Et.uEU;UtM;MsCB;EEEUE苍|}}t4EuG&EǍ&E(t&E p t;Ft'PpuURM1EPv FЃ0vuˋU B BM9MDE؃uVE$PjURjuEPMQuVU҉E0E;EuM1UUEM IMEuЉUԋU;UDMω9w E|{Džxt$ xxw uድx>;EMIx$? x>xusE}E p vvt96ߧUREPMQEPE0v U RMQЉE0t}u}t8Et2uEU;Ut!Mԉ;MB;EEEЋUEԋ|E;Et!2Phd0P2P2}t2Phe0P2P ;Euu N }}u 1U Eu M Ez}$tdu_uE)Ѓ~ 2Ph0P0P衣1;UsU BuTAE9ru V$ ȉX[^_ÍvUWVS[7u E8EU $UEM Au@E܅ty}t#83Ph.0P0Pt&1U B@BK MQťE$PVURjjjMQEPU҉ }u M vUEM IMEE}tEE̍Ut}$"M IMȋEĨ }t&83Ph0P0P&U RUEMEEEMȋQuāwEOw E6w E#wE&E}t&I;Ms $? 9wUE@+E;E UEEE}MMUd)Uȉ d>wdld%=udLd%=ud,d%=ud dNH;Es'vd? dNP;Er܍vdMȉQ MhE9v: E;t&EU*vMMEUp&EEFwM9Mr狅pEƉuUU 1ɋUBEA;EB$<~;EvWEQ;UsAvBE;Us$wt&%=ut&%=ut&%=ut&%=uvt&}t }5Eu;ptV+pEȋȃ92Ph1P2P詝)‹EUUEEȉ1}'E9Eu&2Ph1P3PW&U)Eȋ)ȋM}dMȉd>wdld%=udLd%=ud,d%=ud dNP;Es$d? dNH;Er܍vdMȉQ}t EM EUM M؋EEЋU RUEωEE9EE7wG>w %=u %=uut&%=u X%=u @}U1GB;}$<~&9|U9vFEW;UsG BE;Us$w&%=ut&%=u i%=u Q%=u 9}E1ҐGB;}$<~9lE9vOEW9sG BE;Us$wdvd%=udVd%=ud6d%=udEUhdNM `'t&dU`ъ? dNAE`@;ErˍvdMQH[^_ÐU\WVS[Ru E8EU $UE} Gu@Ett}t3Ph.0P0P1U B@B}WE$PVURjjjuV}WU҉a}u u v}EE @EEE}tUUԍuu}$} }Ћ}t3Ph0P0PF9rA);Ev2UE9s}ЈD>AF;Mrf};}v KEEvAFw;MrM1UU(f=w6}t}ut&E%&ME‹U}M;MtP+EuЋʃ9X3Ph1P2P)Ћ}EEEUЉ ]}uWA9EuX3Ph1Pr3P谒E)ȋ}Ћ)ЋU;Ms&}ЈD>AF;Mr}ątt&EU Eu}?}EEEEU ru v}&‹U};Mt5};}wTq;uwC(f=w̃}t}uEuE}}}t#EUVEE͍E p t;Ft'P耔uURE0URv FЃ0vuˋu F FE9EviEUR2u$VjEPjuEPURuVU҉0tUE9t)Љu)}u 1U Eu u En}$tcu^EE)Ѓ~3Ph0P0P萐1;UsU BuTAE9ru V$ ȉe[^_ÉUlWVS[.u E8EԋU $UEM Au@E̅}t&3Ph.0P0P&EU B@BMQ谒E$PVURjjjMQuVU҉E}uM uEE @EEE}tUUMM}$u vu}t3Ph0P0P E @EEMEEE19UsUvuD7G9rUB);Ev1ME9suD7E@EG;ErEE;Ev#E&EEUUEE@EGw;ErMMMutE}E p vt96UREPMQEPE0v U RMQЉE0t}u_}tYEtSuEHv(=w%}tEu E#EEUEfEMME;EtS+Euʃ9"3Ph1P2P#v)ЋUEEEug}u_E9Eu3Ph1P?2PЌE+EM)ЋuE;EsvUDEGE;ErMMȅt!Eu EUN&M MċuuE @EMuʋu9u;E%uM&}E p vt86؎UREPMQEPE0v U RMQЉǃ0tuP}tnEthu9(=w#}tEu?MEfEEU;UtuF;Ew7J;MEUEM}ȃ}tEuLӍt&E p t;Ft'PuURM1EPv FЃ0vuˋU B BM9MvgE؃uV蒍E$PjURjuEPMQuVU҉0tU؋E9t )u)MuEU E}u M E}$td}u^uE)Ѓ~3Ph0P0P1;UsU BuTAE9ru V$ ȉEȍe[^_UlWVS[Îu E8EU $UE} Gu@Ets}t84Ph.0P0PK1U B@B}W E$PVURjjjuV}WU҉}uu }EE @EEE}tUUԍuu}$*} }Ћ}t84Ph0P0P|U RUEu}}19EsU&}ЊD>F9rA);Ev2UE9s}ЈD>AF;MrEEU9vv}AFw;Mr1EEUȃU&vOE>‹UEEO%f(f=wۃ}t}uE9tT)UЋ ʃ9"3Ph1P2P3v)Ћu}}EEЉb}uZA9Eu"3Ph1Pr3PvE)ȋ}Ћ)ЋU;Ms&}ЈD>AF;Mr}ąt4t&EU Eu}?}EE؋U RUEEu9ƃ;u^f(f=w'}tEu EAϋU&‹}u;}tE;uw2G;MvEE8uU2}}tEUME֍E p t;Ft'P萈uURE0URv FЃ0vuˋu F FE9EviEURBu$VjEPjuEPURuVU҉0tUE9t)Љu)}u 1U Eu u EN}$tcu^EE)Ѓ~84Ph0P0P蠄1;UsU BuTAE9ru V$ ȉe[^_ÉUlWVS[>}u E8EԋU $UEM Au@E̅}t&4Ph.0P0P&EU B@BMQE$PVURjjjMQuVU҉E}uM uEE @EEE}tUUMM}$u vu}t4Ph0P0PE @EEMEEE19UsUvuD7G9rUB);Ev1ME9suD7E@EG;ErEE;Ev#E&EE UUEE@EGw;ErMMMutE}E p vt96UREPMQEPE0v U RMQЉE0t}ue}t_EtYuENv(=w%}tEu E)EEUUffEMME;EtN+Euʃ9x4Ph1P2P-)ЋUEEEud}u^E9Eux4Ph1P?2P߀E+EM)ЋuE;EsUDEGE;ErMMȅt!Eu EUO&M MċuuE @EMuʋu9u;E0uM&}E p vt86UREPMQEPE0v U RMQЉǃ0tuV}ttEtnu?(=w#}tEuEMEffEEU;UtuF;EwE$1e[^_ÍvUS[hsUE 02G{]ÉU WVS[:suv o F$u 4WPo ƒu v$o F$~&F PFP6҃uʃ 5Pv$to Ft5Pv$Xo FWv$Io F )5Pv$1o FF(1e[^_ÐU,WVS[JrEE8u95PhAO5P]5P-yHt􍃤 PeW VEP E}uthB$t ERa}U2@(E^t&E+t&E8щME 8uɫ}vuE0x5tE􋃀 MUD/PiE1 U,EMQE0Ryy‹MQ  0>tXEPU26Mq TpP;yƒ}tx5EP>u}t UB MQEPUR uE t􍃤 PmEe[^_Ít&UlWVS[ox􍃘5Pvet vj5PhEu6蕀(EPEPj|EЅu}wEPvz>Ẻ jEPjj j h u] g‰ t1)PhPEPf3Nj 9rǃ EPyh:$ u8B 9s*r9s"fztB9wB 9sB 9vU th0Lǃ  h0 h &1e[^_ÉU,WVS[mEUh8GEGEu1ɋ E>tFʁt11WU1u֋EE܉1uBUGU)‰UAU;Es(EPEP@uuUDU1uG9r)ƋEf<ue[^_UWVS[lEUΉǰэQ}щM%%?)ĉEREPW]uURMQP)d^‰t@EFB FJNBFF4tQcvVFЉEEe[^_UWVS[&llj։Mh8u=UuUtVWsUEU)‹M1e[^_ÐU\WVS[òkE׉Mh0ut&FEF EUp-V MDI; IUEUE7F ULR U; MIUEUE t9}zMfy lhV A zfzLBD@BB;Et)M@|Gf?#D@WB9uf?U)P!cƉuԋM1UEEEOM̍GEȍWUEM܉N UM@UEFEFF4MU EM<t1EU UʋEEt%EPz/UMEE8E9E^Ut EfxtEt MfytuuMt&jpaƃu +vE0U}tiMEF 5FFF4UJE<t BU‹EȉDžtUBEM}EE+EЍ5L MEDDD4yE<t@ 2UBU‹EDžt2}t̎V y&MAEoE1e[^_US[gh8t Qx]ÉUS[Øg th0x h0 ]ÍvUS[LgUE 02+o]ÉUWVS[gEEP UREP ux}щMȃP_ƃFURuPE^FFMQEPVd uVw10F~t!5Pjs 6P6PUmt&6b Ft#36Pvb F u1Lt&96Pvb FD6Pvb FF~t@}Fe[^_ÍvUVS[×eEU 0tud; u/FN6Ph 6P_6PilHF0vVBw"BF}FtP*b Fe[^US[e \P ]ÐUVS[duFt Pa Vue[^ÉUS[Ød P ] UWVS[Wd} } uUB }47M QlTPu 7 vEEL7PY}ut8tWVj:PBj:T7PWV Fs}EẼ}t U }E} ~j;M Q7rK} эA$)ĉQU RPZDž|M+MD ;u u8tG|| 6|tM+MD |; u΋ u<u| tyEE}|Džppt=px4 4R_=BVR_;Bpp ~B} E}E1}tfT/ PtPtЋPt)̋T9t#; t PfpTP4E} ~;Et; t P,pU?E} 0u̍t&}tM; t PoE} ~׃ tp \uoEDžl} }Htp cR P<t1EPMQuulxt@E; tPaE[}h1DždDž`1}uh\;v9uuh\t&T \‹\эyD  dTd~1`t(h1\P6et Dž`F 1` h2dt h1du }wVUXtVh0XR/T1EdQQUXX1ts}uh<-9uuh:t&T<ƒ 4Q[=AWQ[;AF ~AXM}u'E; t PlEt& PtltЋuTP9t#; t PalTP4;Et; t P3lM tp XukE8[^_UWVS[ZEE&UBU} U E 4 U9EtMtU싄tЋ MU 9tPOkME<UR7 MAMtEVt;Ut M;t R v 7jWj uEE  9tPjUre[^_Í&'UWVS[ÍY}u @<FAu[^_ÉULWVS[JYu8uUx7PNt8u U4Nt8u7PNt":t 8tj/Rgt  W6`t 6`u> M6>ƒuװэA$)ĉQRPOƒEPEPEPEPEPEPEPEPRKE܃0j uEPuuuuuuuuURM QEP WUDE؃@uuAjURuuuuuuuuMQE PURWDE؃@MtudhE؃xuURP;M؃yuYEσEЋE8ƅt!zuEP4>>xt͋>U؉B<>}؅}M7M؋A u7Ph7P7P]װэA$)ĉẻE?tL H4Qu_t -t.u @</u Eă}t/FG?u/FEEă~UװэA$)ĉeȉE?tWv H4Qu_t -t.u @<v/u E}t/FG?u /FEE~URRƃMQQ t1U؋B8u6j/2RPz/tJz/uM؋q)PR_Ut7PRbtUt!7PRau U؋B@M؋QBw@BU؋Be[^_ÉUVS[ßTu FPVuv E9pt@ 9pu@@6^e~ t%vvǨ tF&v%eVee[^ÉUWVS[SEE@@j0LEuVRjdE%=@iMQ^u6uэqD M D$)ĉBR 4VURW[== _=E+vRRRRRRRpR/Blf/SBbf/SBYBT/SYSBIt&/SYSB_B5/SYSfB_B#/SYSfB_EBB /SYSJBP[jWHKE<URQjb^ƋEjURjjuj諥 E t@EЅ}Vbr^t&>&EuuJE{}̉E~FWMQuVHƃ#EPgbuD]7vu)]UE 5( M9t#űuV蟥 EP0\E MQE;8r B;Er ]뭃B PIƃtEFẺFUV FFFMAF19sj1ɋET;VE<u8t#=Ph=P8=PTWt&FD t&VT G;~rUR4[Mqh[^_ÍvUVS[Ou~ tvvU vv`v`6` V`e[^Ív'US[O @ @$ @( <tjuu uEUS[ï>U|P%[ÉUS[Ã>U|P%%[US[W>U|P%[ÉUS[+>U|P%%[US[=U|P%%[US[=U|P%%[US[ç=U|P%@%[US[{=U|P%[ÉUS[O=U|P% %[US[#=U|P%%[US[<U|P%%[US[<U=w  [ÉUS[×<U=w L [ÍUS[_<U|P%[ÉUS[3<E [ÍvUS[<EL [ÍvUEÐUE%UUE @4P%ÉUUE @4P%ÉUUE @4P%%UUE @4P%ÉUUE @4P%%UUE @4P%%UUE @4P%%UUE @4P%@%UUE @4P%ÉUUE @4P% %UUE @4P%%UUE @4P%%UEU R8ÍvUEU R<ÍvUWVS[J:}tE8u-} t U }bMTt 0El0?FPEPAt "6u݅} U UuFM pt&~WEPpAtP WURVAtMQ<Džt!F; t P6J~EE 8}3UUuF M~ tWEP@t5URy<Džt F t PI~ FEM9} tE 8u7}tU:u)} t M }Et}փFP1ǃ,GVURP/} tWM 1u < EPV?uuVw;ƋU 2w GG}t*MtP8;tiGUG t&G lt=PMQM?|&t&PEP.?~6>u>GG; t PHWH} t U }t M}t8 t r1e[^_ÉUS[ä6jE Pu4E ]US[x6E PjuE ]US[L6ujjju u]ÐUS[6ju u/]US[5juj/]ÐU WVS[5u} GPFP=u76=u Gv)Ɖe[^_U\WVS[v5} u1 t /}u E} щM̉ȃ'$)ĉD$Q} WP,EUV(MQT WV Eԃ uȉu}tH9Bu9}tJB rURUt&EU&+AE؋lEt5&EP}WM<t|EEu؃}u Ut&My?/u}E}čD7$)ĉe@& E $)ĉeEPUR ƃuCL@ƒ:"tŅu38 t :."@M؉}ENuvj}W')ffEff E /   ‰M+(222222s2X2ff/A[vf/QUAJ9@9quA59EfA#9UfQquAt&9QM}W 2Em E‹E E}IMЋ}ыUЍD $)ĉeRMQuV}W1ffEff E /   ‰M+t&H1C181'1 1110ff/A[vf/QUAJ9@9quA59EfA$9UfQquA&9QM}W9ff    ¸+獴&X0S0H08000$000Tf.mMt&f.mA>t&.mo1.moA%.mofq.mofqA .moQ}эA$)ĉeU::uEM9:tuu }CG@U<:tMAMBt<:u 8tj/uVW>u}uGtuuH8 t );U؉}tM }tMM MQMUE E uVM UoE܃ uME}Eu>t"URM U2E܃ tԋ<>}};M؉}uЋ}̍D7P-'ƃWE PFP6‰E@PMQR%}~FEF U܉VEFMQ}WV’ Eԃ t90t6V>(EԋBMJ u܉rEB}tuM܋UEE܃ 8 t '(E܍e[^_U\WVS[V-EUMxuE@E܅BU܋RUPM܋I Mȅ?}IM؋u1ɉUU܋R UĀ>tFʁt11݉1u׋Uȉ1BUԃ}tEȋ4ff t&Uȋ4}tM܋QDff;EsMU܋B‹M9LrX X R:"EEuP V@"ƃu7ǃL ǃP 4 P&X X FL P u&L M)Ѓu܋V,L +L P )‰ЃL P t4 Pa&U܋B,HMEEu0Ee[^_U WVS[b(MpF0I;~4r1UOt)ujRB9rE vOu܉Ѝe[^_UWVS['ljU +8⍶''v'%Gt tE&GGU%GUgƋGu)EuG UGtEEdu+1UG U%;&G UEW +(&&&&x&h&X&H&8&(&&&t&ut&1u1uU2t&+u;u%wv;u%gv;u%Wv;u%Gv;u%7v;u%'vGUt|:1[^_ÍvUS[%wg+Xt&%p%h%%x%`%X%t&6 .&!,4@G[ÍvU WVS[6%ǃNPƃt>u1jW;.…tuBuщȍe[^_ÍvU WVS[$l8tCt&l7F; t P5v 5V5 ?u; t Ph5, T u ǃT t&X X R)5X uݍe[^_Ðt&US[#uujuu uX]ÍvUS[#juuu u&]ÉUS[Ø#juu uj&]ÍvULWVS[Z#E܉U؉MԃjPjjjjjjjPj}ܰQEP\ VEЃ@utjxuUEЃxE}ЃEȋu>txuUZ>xt1}=E5t&EPẼtP!&E؅tzEPEPEPEPEPEPEPEPEPƃ0jEPuuuuuuuuV}ܰQEPEPEЃ@u 1EЃxuUwuEЃxu7EǃEċu>txuU:>xtك}tEP2}t us2EЍe[^_U WVS[N!\ t0t&Ftv 7%2W2 uՍe[^_Í'Ut!| t&F>t DP ujj WVC|B4;ut*lEuVBuF|B0|P0@4X[^_ÍvUVS[?ƋV09tw~tv6n 6+V*e[^ÐUWVS[1Ht` P EE t&hPj EP 1txx1a€::uvЍJʀx:t틋vP@t<:u拓9s )ʉ?ƅ[8uH t` Pe[^_U,@WVS[B$)ĉjPRQVZ!PQ!PV&u1*jP Dž&j V'u4Rh V&tj V&t҉|0DV t ADB u!<#Axt!P A9tDP t9tA|0DV t&ADB u9AztR vA9t DP t< u A t 9 r щщ|  9v|=s‰Rx ƃ.9x t&1ɋ 9s +x TA9r扳x | x RQP | | x RQPg D| u"Rh V#;Q\thPj 6 ȿ[^_ÐUVS[/ dt4P ht 1 t&e[^US[x t P% t P%]ÍvUS[ÌUE 02{!]ÍU WVS[Zuu&t E8>t Vu U-WVuVrƅt)E0t 9t; t W$8 t 9e[^_ Ut 8tj/V t }EPXEZ8Qǰэ$)ĉejyPuVEP*ffEff E :   ‰M+vhff:A[vf:quAJ9@9AEA59EfA#9EfAquAt&9QMEP uu Ej ƃtVEPEPEPRue[^_ÐUWVS[u} tkG~f}}^DFXE1vREN Mt&E9EE:uk}эq~;}r.UMMȃ$)ĉejREPVURMQ}B&3%EUBU렋uFt<_t <.u<_yF >.m}G;}r+UEE$)ĉeMQREPUMF}>!멍&uFt<.u<.F}G;}r+UEE$)ĉeEPRURHMU F}>uuF;ur+UEE$)ĉeMQREPUM%qEUtd<:tsEMtT<:uNuF;ur+UEE$)ĉeEPRURMUMEuU<:tE@;Er+UEE$)ĉeMQREP4UMtjRxE}EE8}} TEPURj(E%=uEЅu} wt&E̋MAjURjjPjJ MA tmuUBũVE)MAPEPtuu .8t UrW)ƅuMUB=u1\=u4M9uqqJ Ep"MA@ff t&MA@At UB@ffB&MA@AEHQ UP pP@D MAEuC‹E}S̀[=v ؉}8:&u3E}SÌ[Ɓvމ0[^_U WVS[h >uC‹E}S̀[=v ؉}>:&u9E1MSH̀[Ɓv*މ0[^_ÉU,$WVS[WE0EIyDžxF|&Iyǃ  1Mt)ҋ!PPWu&FG?~R6w ~OwMt j)PW7 E  1҃u‰Ѝ[^_ÉUS[E [ÍUWVS[×EEIyt&VуEs  F v݃PPj}5EFt UF vE[^_Ív'UWVS[÷EEIyt&VуEs  F v݃PPj}5EFt UF vE[^_Ív'UWVS[} tBuVjj2||UJ!V^t&E|EIy|VуEs  F?~݃|Rh[^_ÍvUS[juX]ÍvUS[ju0]Ít&'UWVS[÷E u1t\&HuX0@ʃutIylVW7t&H up \HtP\PEP$}S}tKt1ɋup 9uEØ xtuuFN1H[^_ÍvUWVS[ UЉp@Džtx|tht&IyENj7pljhREP!7URlЍH[^_Ðt&U,WVS[Eu 11ɅtMtUxǃ}UUQR"…utEEFЍe[^_ÉڋL$\$̀=sS[1ҁG)RY[ߐt&UWVS[}tVjW#||} t& w e4t& wppp!MjtPW| 1 &X[^_UVEu N%^UVUu N 1^ÉUWVUu N!1^_ÉUWS[}t 1 d[_Ðt&US[ÜEthhP1]Ív'UVS[KuE t ~?~&Pу 1[^Ðt&U WVS[uE t ~?~sP!1[^_ÉUVS[ËuE t ~?~$&Pу%[^ US[&[ÉUS[j;]ÉU,WVS[UE t ~?~OW&ttEIyEVWR| [^_US[,Uu(t&B|ut&uIy%[É'U WVS[U}t } tuS-|u <#<u<Iy1[^_Ít&U WVS[ZU}t } tu-|u < <u<Iy1[^_Ít&UVS[1xPuxPP[h[^US[Ôuǃǃǃ ǃ?ǃ[ÍvUS[8u[ÉUS[ uW[ÉUS[u+t 9~&}t  [Ðt&U WVS[z}M US̀[ǁv߉8[^_ÍvU WVS[*}M 1ҾS̀[ǁv߉8[^_UWVS[uE|1 } }EElEu}M |S̀[Ɓvމ0[^_ÉUVS[HuVjj}#UJу jVjxh[^Í&'UWVS[uVjj8}%UJ!jVjh[^_Ív'US[iDžttEIyEjRuOhÍ&UWVS[}E uQhWIyу jVj.t ~?~9ttEt&IyEVRWr|RhW&Iyу jVju|H[^_É'US[jju]ÐUS[äjj ju]ÉUS[|jj ju]ÉUS[Tjj juW]ÉU WS[(Ht􍃼Pu>ǃpIy jRj:uǃjuWǃ t􍃼P<jOHt􍃼P4ǃuQǃt1#DžtEIyEjRjuǃUuǃju ǃ􃻤uǃjt&'UWVS[ZE}9}sBuEE EPEPU҃}А E&Fu1e[^_U\WVS[E UPUUQEEE9+1uEPRU҃UU)}׋FAOuPRU҃}`}t&FAOuPRU҃}#}&FAOu ERPU҃| E)RPU҃|ڋ9s|})FAOu9u9u t&9tb9+;w\+;|REU)떍+;vR9~.P,B9UEЉu9v;wVWU҃}};v;ut}Mt&FAOu};+uE+uVWU҃|u9tPH9rE+UA9rt&+U9s9s;q[^_Ít&UWVS[} q} E E)}UUEЉEEPUREPWUR EPUREPUREPu }U}EPURU҃OUUt&MUU}ufEPURU҃&EPURVƋEEO&&UREPVƋUUMt}ut}WEPVQU)U E EPUREP0e[^_U WVS[Â} }w'G$)ĉPEPEPE PEP"uKjU*u ǃ}j1;w#ƋEWǃuEEPEPE PEP*EWEPEPE PEP_ We[^_Ít&'U WVS[Z}ыd U:Uzu7f:=ƃ>t|f;8t >uebUDYU:MUƃ>t=&f;8u'URURP5u U|=t>u1e[^_UVS[{uj=V>u V17)PV~B$)ĉRVPjVjPe[^ÍULWVS[}IM} t} щMEHt􍃰P葻d EEtP8t9vuVEPU2u M<=tEEu>uʃ}t E8xUPE}tEMuUBUMD $)ĉeuVE PQURMQffEff E =   ŠE㊃EEuuċE+9捶=Aef=A[f=EAAK9AD&9UQA0v9EfAA9UfQEAA9QAP] URWMQ+ 1҅tuEu\uuV6UMu 5VuVP¼EPWUM4) d ;tEPREP腼UMD&}}t}uFuԋUD$)ĉe؃MQu VREPUR7ffEff E =   ŠEъEEЋuԉuċE+ t􍃰Pq1e[^_ÍvUS[Ðuju uq]U WVS[f}tE8tj=Pt}эyHt􍃰Pd 0>t;WEP6gu <=uBulj t􍃰Pc1e[^_ÐUS[ÄHt􍃰PMd ;utPMǃd t􍃰Pܾ1]ÐUS[d,  , ǃ]É'US[ü 8t1 uC]Í&'U WVS[z}8qt&BHJDwM+?⍶pWv@Wp@ЃxutR8\ ;< s&Ѓ;< rW&US[|p…tEBE B1[Ít&US[<0…t"EBE BEB 1 [U WVS[1HtP蹲0t:1V9s"~tэFG9s 8u9r vj6uʅu+hSƃt"2F1D0 tPtD> vF1e[^_ U WVS[}tX8tLGtGE9r2t&E;F uujvFЃ;usӋ?ue[^_Ðt&US[| 1҅tRju]UE}ÉUE}ÉUEU  uw؃UWV}E E։u} | }E)}EUMQE^_UWV}E E։u} | }E)}EUMQE^_U,WVS[ÊEURPu }WVEUEUEURPWV(EU|$}}u}u}+EUEUE}EGEGEG Ee[^_vUS[Uu88 9tkǃǃ @0=:u 14t&ǃǃPu Rj}]ÍUS[LMUEE@PRE PQ]ÐUS[ UE u78 9tj@ @0,8ut1uPRٿ}]Ít&'US[|MUEE@PRE PQ]ÐUS[<Eu88 9tj@ @@0u P ]Í&US[̹Ht P蕭XPup t PE]UVS[kHt P4X`Puu u' t Pضe[^ÍvUVS[Ht PX`Pu}1 t Pae[^US[ÄHt PMEPXP# t PE]ÐUWVS[E} M Q IMuMMƋE x~|WU_ N )щ))ʍ)Ѝ)4)Ѝ4)ƍAȍ)yEU2MuM AEEAt:tEЀ<t MI;Ms;ME)ȋ}7V9AEEU:uJUI}<t}S;MrCEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;Ms;MsUĉUM}?};MrIEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;MsɋE);MsE);E~E;Mr ;EUU9~ tuMċM9MQE;EsEE}ĉ}EE܊EU։WVjj贚EUWVjj0EEMM1ɸ1uE}}9}ut&E< va}tA1;Us }}8uB;Us}:}8:t;UuUE̍TU>UDPtFL ɈEU;U}-;ME EEEt U9U]ME"E< vv}tO1;UsM}8uB;UsM }8:t;UuUE̍TUvUMt&U}DPL ɈEE;EU9Uw$9Mu}9}wU9Uu M9Mu;EvECME}}}EeƉ׋MMϋEEEu}EUEUUt M9M}9}} tUE }u2}t}wu}wv}vE}t-%"}tgYEU}tM؃D} t:E+E~'MAL t:tEЀ<t MI;Ms;ME)ȋ}7V9AEEU:uJUI}<t}S;MrCEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;Ms;MsUĉUM}?};MrIEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;MsɋE);MsE);E~E;Mr ;EUU9~ tuMċM9MQE;EsEE}ĉ}EE܊EU։WVjjTEUWVjjВEEMM1ɸ1uE}}9}ut&E< va}tA1;Us }}8uB;Us}:}8:t;UuUE̍TU>UDPtFL ɈEU;U}-;ME EEEt U9U]ME"E< vv}tO1;UsM}8uB;UsM }8:t;UuUE̍TUvUMt&U}DPL ɈEE;EU9Uw$9Mu}9}wU9Uu M9Mu;EvECME}}}EeƉ׋MMϋEEEu}EUEUUt M9M}9}tD} tUE }t"YEU}tM؃Dt&} t6E+E~#MAL UBt8}:uUJ&JFEEt:tU<t MI;Ms;MBE)ȋ}7V9AEЍE؋U؀:uJUI}؊<t}W;MEEt&1}t2U}:T9uTJFEEt:tU<tI;Ms;MsM̋}?};MrOEEt&1}t2U}:T9uTJFEEt:tU<tI;MsƋE);MsE);E~B;Mr ;EM9~ tuM}9}AE;EsEu 1EE1uEȉUEEM9u}}A< ww}tX1;Us%E}8ut&B;UsE}8:t;UuUETUdыMDQtk}G<vыEDPtSMA< ;E}?}9}wu;EvE&UU‰UE}t97E9Eth} tMU }u'}t}w v}}E}t"}tS@Pt&E}tC?v} t4E+E~!}WMA<UBt8}:uUJ&JFEEt:tU<t MI;Ms;MBE)ȋ}7V9AEЍE؋U؀:uJUI}؊<t}W;MEEt&1}t2U}:T9uTJFEEt:tU<tI;Ms;MsM̋}?};MrOEEt&1}t2U}:T9uTJFEEt:tU<tI;MsƋE);MsE);E~B;Mr ;EM9~ tuM}9}AE;EsEu 1EE1uEȉUEEM9u}}A< ww}tX1;Us%E}8ut&B;UsE}8:t;UuUETUdыMDQtk}G<vыEDPtSMA< ;E}?}9}wu;EvE&UU‰UE}t97E9Et8} tMU }t?"NE}tC?v} t4E+E~!}WMA<t:tEЀ<t MI;Ms;ME)ȋ}7V9AEEU:uJUI}<t}S;MrCEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;Ms;MsUĉUM}?};MrIEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;MsɋE);MsE);E~E;Mr ;EUU9~ tuMċM9MVE;EsEE}ĉ}EE܊EU։WVjj蔀EUWVjjEEMM1ɸ1uE}}9}ut&E< v]}tA1;Us }}8uB;Us}:}8:t;UuUE̍TU:UDVtD}G<ɈEU;U}-;ME EEEt U9UaME2E< }t]1;UsM}8uB;UsM }8:t;UuUE̍TUUMDQ}G<UEDPMA<ɈEE;E}9}w$9UuM9Mw}9}u U9Uu;EvECMEMMMEeƉ׋MMϋEEEu}EUEUUt M9M}9}} tUE }u6}t}wu}w&}vE}t-"}tg YEU}tM؃D} t:E+E~'MQ}G<t:tEЀ<t MI;Ms;ME)ȋ}7V9AEEU:uJUI}<t}S;MrCEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;Ms;MsUĉUM}?};MrIEE1}t/U}:T9uTJF}Њ>t:tEЀ<tI;MsɋE);MsE);E~E;Mr ;EUU9~ tuMċM9MVE;EsEE}ĉ}EE܊EU։WVjj$yEUWVjjxEEMM1ɸ1uE}}9}ut&E< v]}tA1;Us }}8uB;Us}:}8:t;UuUE̍TU:UDVtD}G<ɈEU;U}-;ME EEEt U9UaME2E< }t]1;UsM}8uB;UsM }8:t;UuUE̍TUUMDQ}G<UEDPMA<ɈEE;E}9}w$9UuM9Mw}9}u U9Uu;EvECMEMMMEeƉ׋MMϋEEEu}EUEUUt M9M}9}t@} tUE }t过"YEU}tM؃D} t:E+E~'MQ}G<uUBt8Et틅x<uEM M빍t&E< vM}uG u;|;~+1t U:uFMt}:>tEEEE< v}uE `~ fEBxtG1xt+M:uFx>tU:tꋍx<uEEE널t}UdxI`M9adIt\;M_x[```dt2[`8DuFxGt@`: uJvJFx>t:t틅x<t I;Ms;Md)ȋt2V9`qT&\\?uO\I\<t}w;Mra_1_t;`:T9uTJFx>t:t틅x<tI;Ms;Mqd\;Mr_^1^t;`:T9uTJFx>t:t틅x<tI;Ms);Ms);b;Mr ;Tdt&9~ tddM9dd;EsE9Utm;Uu} = }u >0 ;Us} ! E  UEUM9s< wEB;UruuE}}EuE1 t#U:uvF}>tU:t}<>uZ|EUU9U`~7f2}0t}u uu})}EEEE< vԃ}t}}uUt}:>tE<tE렋u}u E)+MMU} DžHDžD}|0NjEHD8MDEuBt8tꋅt<u 먊< v\uS ;|;~413t)3:uF|t :>t狅Dž< v%u% `~f GttW1tt/:uFt>t:t狍t<ugpuh`tI\9{v`IpX;ft2W\PP`t2W\8DuGtGtDP: uJt&JFt>t:t틅t<tI;s;`)ȋp2V9jqPXX?uOXIX<t}w;rd2Ov1Ot>2\:T9uTJFt>t:t틅t<t I;s;k`X ;rl2N&1Nt>2\:T9uTJFt>t:t틅t<t I;s);s); X;r ; P`9~ t``9``;s9;u} k }u >^ &;s} E E ; t&Dž9s< wB;r鋵DžDžu Dž1 3t)3:uF|>t :t狽|<>x\`~XfS0t!u)< vtut:>t狅|<t낋u )+DžDDž@|0NjHI4DVuDBtꋵD80ut&:0tDPt  © @)ȍH⋽4>@DD4D|DPu xDPt A ©@@~ @ 7@+@ 7@D<8Dž4!ǁ+<5(t5uO4@8Dž414<t@~4IyF}F484)414<tBȅ}F9|4H8t}F)P)P4 QPUH1)4A}F9|,~(8F4Vj4RRGDž<844uuH84B49sBu Ou t&9t1O9}t&B9|4G tuBt8stꋅd<u s먊s< v\uS s;|;~413t)3:uFlt :>t狅Dž|s< v%u%s `~f |GdtW1dt/:uFd>t:t狍d<usg`u|hXdIT9{vXI`P;fd2OTHHXt2OT8DuGdGtDH: uJt&JFd>t:t틅d<tI;s;X)ȋ`2V9jqHPP?uOPIP<t}w;rd2Gv1Gt>2T:T9uTJFd>t:t틅d<t I;s;kXP;rl2F&1Ft>2T:T9uTJFd>t:t틅d<t I;s);s);X;r ;HX9~ tXX9XX;s9;u} w }u >j &;s} Q E G t&Dž|9s< w|B;r鋵|xDžts|xDžtu Džt1 3t)3:uFl>t :t狽l<>hs\s`~XfSs0t!tu|tx)t|s< vtust:>t狅l<t낋u t)+t|Dž<Dž8|0Nj|HxI DVuDBtꋵ<80ut&:0tDPt  © 8)ȍH⋽ >8D|< <|DPu hDPt A ©8@~ 8 78+8 78<|40Dž,!ǁ+4@))t@uK @01 <t@~ IyF}F 0,),1 <tBȅ}F9|,H0t}F)P)P QP 1) A}F9|-~(0F,Vj RRG Dž40, uuH0 B 9sBu Ou&9t<1O9}5t&B9|#v4jj WW O"4u x} Dž44@~H)۫e)R4Q VC) 08||~ <O1;<} @;<|(Dž$Dž Dž)փ@ &uX I$Dž 1 <t@~ t&IyF}F <$ ) 1t& <tBȅ}F9|ܸ H$t}F)P)P QW 1ɿv) A}F9|0t&~($~ Vj PP Dž($  uuH$ B 9s &BuOu9t81O9}1B9|#v(jj VVYN"(u } Dž((@P()&}xމ9}|+x9~x)‰x=E~,"t ۫%۫$%}"%$(X"t۫0 ۫< t&@zyB)‰uDžuJB O 4J O 49}qDž ) rt&Tꉵ ‰FH9|+ꋍ Q1҃uB<t471ɋ|9x|;} ρ + @;Ht@uO vDž1 <t@~ IyF}F )1 <tBȅ}F9|Ht}F)P)P QP1) A}F9|-~(FVj RRGDž uuH B 9sBu Ou&9t<1O9}5t&B9|#vjj VVN"u } Dž@PYx9|H y $ )u`)ЍRRP1+ 9B+9|a)PRQ)ЍP1+ 9vB+9|bAPRV)ЍP+ 1+ 9}B+9|싽 DžDžDž)@uX @Dž1t& <t@~ IyF}F <)1 <tBȅ}F9|ܸHt}F)P)P QW1ɿ) A}F9|0t&~(~Vj PP'Dž uuH B 9s &BuOu9t81O9}1B9|#vjj VViN"u } Dž@P9PWV;$ |+xB+VUUU)B9~xT |Dž Dž|+x+DžDž@ 3u7V ƒQRQ-p􋅐PRFP PQS‹FL uIɉ%9uPVWw@1DžDžJH, $uhʚ;PWW9$Љ9s(Itt&BuIu$&9t1I9}t&B9|1t$41DžAЋ~< v\dtGd:u=@t%:FuAd1t :1t狅d<thDPЉF,p(~38 +<4( t&<$ut&RPWWq$0ȉ9s,NtA uNu(t&9t1ҍN9}B9|1t$ ~JVPRRVQQƒ t0t! t&11Ɖucu փ) )Ѓ@~z@)艅DžA Aډ @ t& DJ1T@+~E u DJ1$Wj PPJ )  @H)1҃u t=)ƃ@Ht@uR vDž1v <t@~ IyF}F )1 <tBȅ}F9|Ht}F)P)P QP1) A}F9|-~(FVj RRDž uuH B 9sBu Ou&9t<1O9}5t&B9|#vjj VVN"u } Dž@lPDžDž|9r 1 @" DJlvDž|@)||~J| u(v DJ|Wj PPJ1t&;u=Dž 79s+1ϋƃhtO"ыƉ9wu!t+;s1)ωƃu ) )Ѓ@~,@|)ы艅DžAt& Aډ @ & DJ?Dž|@)||~_| u$ DJ5v|Rj QQj +|  @H+|1҃uutxtp=)ƃ@pHtt@uQ vtDžp1 <t@~ IyF}F tp)p1 <tBȅ}F9|pHtt}F)P)P QP'1) A}F9|-~(tFpVj RRDžxtp uuHt B 9sBu Ou&9t<1O9}5t&B9|#vxjj VV N"xu } Džxx@|PxDždDž`lhR)ЍPP~;2)уy~3\4J\I19}t&@9|)v‰@y DJF~3X4JXI19@9|Dž`@)``~``}`)Rj VP|o Iy]t&`~A` u DJ`Vj WW,Ћ~HʋDIDŽ)<1@;luDždGldhdljA;hs+h9wu+;uDžxDžtR UװI|EEEUJUMQ4EEEDB u}-uEEUU}+u EM M1Et$U8uFMt}8>tE<uUBt8Et틅x<uEM M뷍t&E< vM}uGuF8u;|;~+1t U:uFMt}:>tEEEE< v}uUMA8`~ fEDxtG1xt+U:uFxt}:>tꋅx<uEUU널t}MhxIdU9U`hIt`;M^x_d\\ht2_d8DuExGt?\: uJJFx>t:t틅x<t I;Ms;Mh)ȋt2V9`qX&``?uO`I`<t}w;Mra[1[t;d:T9uTJFx>t:t틅x<tI;Ms;Mqh`;Mr_Z1Zt;d:T9uTJFx>t:t틅x<tI;Ms);Ms);b;Mr ;Xht&9~ thhM9hh;EsE9Utm;Uu} M }u >@ ;Us} 1 E ' UEUM9s< wEB;UruuE}}EuE1EP8t#}:uvFMt}:>tE<uN|M/E`~7f2}0t}u MMu)uEEEE< vԃ}t}}uEt}:>tE<tE렋u}u E)+MMU}-DžLDžH}Ur4MI4UJ0UHDFuEUDFtLu>0u EE80tE0Dwt @E}G8E4Ʃ MH)ȍH拽H4:H0MDE4u2L%DLUuN4DAu |‰UuDQtrEMA8E4ƩH@~"H担D 48H+H苕D :HLN}}@Dž<8Dž4)44O!t84uLu@Dž<1H<t8@~1ɋHIyG44H} 4H@<)<1&H<t8Bȅ} 49|־uDžtDžpR |װIxDžDžDžUJMQ4&DB u‽-u Dž+u 1|+t/8uF|t8>t狅|<uB(}O8B< v닽`~z~Հ_tЀ)t EPjjPFP۽hlۭ9{hl## ݝuhll1҉% ׋h݅} 68E &8v} }uM 1p0u;WMA8t8tꋅt<u 먊< v\uSuF8;|;~41+t)+:uF|t :>t狅Dž< v#u%MA8`~f IvttW1tt/:uFtt:>t狅t<ugpuhdtI`9wdIp\;et*[`LLdt2[`8DuFtGtCL: uJvJFt>t:t틅t<tI;s;d)ȋp2V9jqT\\?uO\I\<t}w;rd*Kv1Kt>*`:T9uTJFt>t:t틅t<t I;s;kd\;rl*J&1Jt>*`:T9uTJFt>t:t틅t<t I;s);s);X;r ;Td9~ tdd9dd;s9;u} k }u >^ &;s} E E ; t&Dž9s< wB;r鋵DžDžu Dž1EP8+t)+:uF|t :>t狅|<u{xP`~XfS0t!u)< vtut:>t狅|<t낋u )+DžHDžDUr4IJ X,DFuDFtꋕH>0u80t0Dwt@v}G84Ʃ D)ȍH拽,4:D DH@HvuN4DAux‰DQt rMA84ƩD@~"D担@ 48D+D苕@ :DH<8Dž4ǃ0)σ5(t05uU,@8Dž41,<t0@~,IyG}G,484)41,<t0Bȅ}G9|ܸ4H8t0}G)P)P, QV荟1ɾ),A}G9|0t&~(8w4Wj,WW'Dž<84,0uu4H8,B,9sBuOu9t1O9} B9|,G tuDždDž`R lװIhDžDžDžUJMQ4&sDB u‽s-u Džss+u s1lt/8uFlt8>t狅l<uBt8stꋅd<u s멊s< v\uSuF8s;|;~41t):uFlt :>t狅Dž|s< v#u%sMA8`~f |IvdtW1dt/:uFdt:>t狅d<usg`u|h\dIX9w\I`T;edSXDD\t2SX8DuFdGtCD: uJvJFd>t:t틅d<tI;s;\)ȋ`2V9jqLTT?uOTIT<t}w;rdCv1Ct>X:T9uTJFd>t:t틅d<t I;s;k\T ;rlB&1Bt>X:T9uTJFd>t:t틅d<t I;s);s); X;r ; L\9~ t\\9\\;s9;u} w }u >j &;s} Q E G t&Dž|9s< w|B;r鋵|xDžtS|xDžtu Džt1EP8t):uFlt :>t狅l<u{hPs`~XfSs0t!tu|tx)t|s< vtust:>t狅l<t낋u t)+t|Dž@Dž<Ur4|I0u80t0Dwt@v}G84Ʃ <)ȍH拽4:<8D<|@8@vuN4DAuh‰DQt rMA84Ʃ<@~"<担8 48<7+<苕8 :<@|40Dž,ǃ()σ@C)t(@uN@01<t(@~t&IyG}G40,),1t&<t(Bȅ}G9|ܸ,H0t(}G)P)P QVd1ɾv)A}G9|0t&~(0w,WjWWcDž40,(uu,H0B9sBuOu9t81O9}1B9|#v4jjWWbO"4ux} Dž44@~H)۫e)R4QVC)48<||~ @/1;@}@;@|$Dž DžDž)փ@ &uXI Dž1<t@~t&IyF}F< )1t&<tBȅ}F9|ܸH t}F)P)P QW`1ɿv)A}F9|0t&~( ~VjPP`Dž$ uuH B9s &BuOu9t81O9}1B9|#v$jjVV_N"$u} Dž$$@P$)&}xމ9}|+x9~x)‰x=E~,w["t ۫x%۫%}C["%0xM ~       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~x1DžDžH( u!Džhʚ;PWWa Љ9sItBu Iu9t1I9}t&B9|1 t 1DžAЋ~< v\dtGd:u=@t%:FuAd1t :1t狅d<thDPЉF(t~-8 %0 Dž 0uDžRPPP_ȉ9s-Nt#t&A u Nu$9t1ҍN9}B9|1t#Dž$ t&w39|(V PQPR&QQV PP[ 򉕠uJ49uPWPAqʉ+=@~3V"t۫ ۫ t&@zyB)‰uDžuJBO$JO$9}qDž )rt&Tꉵ ‰FH9|+ꋍQ1҃uB<t$71ɋ|9x|;}ρ+@;Ht@uOvDž1<t@~IyF}F)1<tBȅ}F9|Ht}F)P)P QPW1)A}F9|-~(FVjRRVDžuuHB9sBu Ou&9t<1O9}5t&B9|#vjjVVUN"u} Dž@PYx9|Hy $)u`)ЍRRP<1+9B+9|a)PRQ)ЍPT1+9vB+9|bAPRV)ЍPT+ 1+9}B+9|싽DžDžDž)@uX@Dž1t&<t@~IyF}F<)1<tBȅ}F9|ܸHt}F)P)P QWR1ɿ)A}F9|0t&~(~VjPPRDžuuHB9s &BuOu9t81O9}1B9|#vjjVVQN"u} Dž@P9PWV8$ |+xB+VUUU)B9~xT |Dž Dž|+x+DžDž,3u7V ƒQRQ7p􋅐PRFP PQP‹FL uIɉ%9uPVW6,1DžDžJH uhʚ;PWWRЉ9s(Itt&BuIu$&9t1I9}t&B9|1t41DžAЋ~< v\dtGd:u=@t%:FuAd1t :1t狅d<thDPЉF p~38 +04 t&0ut&RPWWP0ȉ9s,NtA uNu(t&9t1ҍN9}B9|1t ~JVPRR1LVQQLƒ t0t! t&11Ɖucu փ) )Ѓ@~z@)艅DžAAډ @ t&DJ1T@+~E uDJ1$WjPPJ )  @H)1҃u t=)ƃ@Ht@uRvDž1v<t@~IyF}F)1<tBȅ}F9|Ht}F)P)P QPI1)A}F9|-~(FVjRR'IDžuuHB9sBu Ou&9t<1O9}5t&B9|#vjjVViHN"u} Dž@lPDž|Džx9r 1 @"DJlvDžx@)xx~Jx u(vDJxWjPPF1t&;u=Dž| 79s+1ϋƃhtO"|ы|Ɖ9wu!t|+;s1)ωƃ|u |) )Ѓ@~,@x)ы|艅DžAt&A|ډ @ &DJ?Džx@)xx~_x u$DJ|5vxRjQQD +x|  @H+x1҃uutt|pl=)ƃ@lHpt@uQvpDžl1<t@~IyF}Fpl)l1<tBȅ}F9|lHpt}F)P)P QPC1)A}F9|-~(pFlVjRR7CDžtpluuHpB9sBu Ou&9t<1O9}5t&B9|#vtjjVVyBN"tu} Džtt@|PtDž`Dž\hdR)ЍPPf=~;2)у4y~3X4JXI19}t&@9|)v‰@4yDJF~3T4JTI19@9|Dž\@)\\~`\}\)RjVP?4|oIy]t&4\~A\ uDJ\VjWW ?,Ћ4~HʋDI4DŽ)<1@;huDž`Gh`d`ljA;ds+d9wu+;j0Pj4\8XIyU4Ƌ>8P4Pj @}D&t;ǃj0Pj3j\Pj3>f&>5DžLPETDžXjPj!3j\Pj3 j\PjH?d 0LPP j4|6H @ tD8&D8H[^_ÍUWVS[% }EEuN2bv?u62J} t eh=EEE?/tt+\jjjUB0W/@1҅tЍe[^_Í&'U\WVS[ EUM9*t&%t3}M D99 F v%uDUM D9N GF t&Dž DžDžƅ DžDž<+tg<u8u9ut UE Mu>tFuUEE3EMu <uUEM9tAMEue[^_UVS[Û ut>u Zj/Vu Gt&xu;H9v%x/t9vH9v#x/tH9vx/uxt @xu@e[^Í&U,WVS[  E@uBuǃv} t]j:E P…u% PPS뾉+E эzэAwUtM; tE@EtU;u}tM<Et } ȉM1t }Et}%E1t }1t }, Ez\Eu( P( t tA PEu( P( tD P( }t tM RE}u( P( tE tO R( tUBP( }t M tO PE }u( PX PM1Eu( P( t tA PEu( P( tD P( }t tM RE}u( P( tE tO R( tUBP( }t M tO PE }u( P PM10uEE} ЉU}Ѓ}ȉM}}Eu( P( t tA PEu( P( tD P( }t tM QE}u( P( tE tO Q( tMAP( }t U tO PE }u( P Pj#Ee[^_U,WVS[ PdE PRE }E8E UU썋 M1҉uE<E uMM<:tt E}vʃ}w6M EEU::uBUM9p ǃ}H􍃼Pj:URǃ9}stMAM<,u9scEjjPQEE;EtG9sCE<,u:}~4E)RPƅtE0t V7 }?:uEE8]e[^_ÐUWVS[ ljUEE t&uvtK9>utCv }t EF]}u F FUBV 6}t)j Kƅt>FEFEEe[^_ÉU WVS[2 } }~tWƅu S1Ht􍃼PEDžt V  t􍃼P|e[^_ÉU WVS[Ú t(?~w Vs ًԍe[^_ÐUS[L juu uM]US[$ juu u]US[ juu u]]US[ juu uU]ËD$@@H}~EEPMQEPURu}~!uuUUMt&IuMQEEMRPPEEPUREEPP)E }CEEPMQE PURMQEPuuVVcE}tRMuyEЉ9s!uNt2&BuNu9t1N9} B9|1;U}MMB;U|EPEEPEEPPt[uuUM<ыB9sIt6Bu Iu"&9t1I9}t&B9|e[^_ÐU WVS[F }u MU9u-RVWEt&$)TRVW* RQVW $)ĉPRQVWe[^_Ð&WV|$ t$T$L$؃t"A)))$ FBGFBGF B G FBGFBGFBGFBG v R Iu^_Ð&WVUS|$t$L$\$ <41)Au[]^_Ít&UWVEu}%MM1Quuut&tCE@4EMy )΋EЉ Nju~M)TE4E ~ƒMA# +UMqUM+Eu EP^_É'U WVUm}E E%UEMUQEuuEUzzt=σMt& )΋EЉ NjMyMM+E(Mt'ЃMA)ЋUvMAE^_Ít&UUE E % % MEUWVMU% ׋E % Nj1Q% ׉u}E^_ÐU$VuU ME$ȈE?E% fEEFEm^ÍvUS[ Uuj PRF]ÐU0VS[Ø uPhPP uPd u u tuj 0V)[^ U| VUBF)VWR@Ѓ9o$8!ADžDžDžDžDžDžDžDžDžDžDžDžƅ H@BЃ vt8$EE@DžBЃ zB LHЍBBЃ v㉍\EUB$HNE}G$7&EMA$0Dž9~( =~B/$)čT 3  9r`@)ĉ >9t VWR19u <\DžBXG$g G G $G XЋF$ wX@X LHЍBBЃ vȅt0X:$u%BXPW$9sЋ XX)+Fⰸ e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e O ,O @$O t&O G0 O O XHXxG tG G GX:*rXBЃ whXBXB LHЍBBЃ vȅt.X9$u#PW 9sЋAX }hO ADžX@Ѓ w5XBX LHЍBBЃ vOGX:.JXz*rXBЃ whXBXB LHЍBBЃ vt0X>$u%QWȋ9sЋFX}pOAXLBЃ w8XBXB LHЍBBЃ vg g XX.+J␍& (  t&X8htO =@XO 0O X8lu@XO g O XXWX 8t5-p < tG(PjW ЉG,t&G,G7+K (  ( ( ( x ( = x ( ( ( x Ȳ x ز x x G t G(G t G(t G(G t G(G(wG t G(hG(^&G(N&G(>&G(.&G(&G(&G,$uG,tw$u'XHGGiXGX3Džt!Q轰PV6~Ft<%uʼnw D$8\9sP)ԉPjW蘷R$)ĉDž9$Ft Ft ~t@uF+p VPWW Ѓ009mDž9+8 ti$t& =tr===tBGfGWQv@Byt& n9`BLF8t&tG&AA 9V9ɋ<D8 gƒhgƃ`gƒ\gƃXgЉTD: PgƃLT: ЃHgƃDD8@4><Ѓ8T:7D86D: t@@D:}؉D:g D: Dž\|:@Dt)@}<@<9}Ѓ =~5@<9}ȃ/$)ċ@<9}D 6$@D:$@||92&Džp t&Džpt&DžpDž|DžXDž`P<uEUBRtx&D9$@4|tx<|]ƅ7 <uWt xuI lphll0t&Dž<6X%PpQ PtxQRl Tt3(t*,Q( ll 8t(p u PlRlt xtZ<uPHtEUBtLuEMIt}Eu~tjHt D:$@ tBLuD:$@wD>$@t<|Vƅ7 <uPtuG lpAh4ll0 vDž<t6Xup  p tw ptAQpt$FO)1хu:Oȃ0u(Oȃ0uO1p2uꉽlTt3(t*,R( l l 8t(p u PlR l +l9<*tt!htpull0 +l))@tthtpu@|uXu `t@7 u1@~@Pj UR$Dž@|t3MA;Arj-Q$@t:DžptDž|DžhDžTƅ6xl< Dž<DžD<uzPt!EMA$0pKt&HtEUB$'LuEuFEUB$fPt)D>$@$PHt%D>$@$Lu'D9$@$8kt&D:$@$f0ChPWlDžD}D@\u'@~@Pj UR$ ʉu"E}W,t&RP2D$@EH;HsΈЈ%UB$\:@-@Qj uVA$ v0՚%%?)ĉ捅HDžH@P<u EMAD:$@PVǃ)@\u'@~@Pj URq$MAFWVQ@Ѓ9$\t%@~@Vj }W$0t&@uEURlD$@lDž,lu<0 Љ,tW$)ĉe)ĉe)ĉeEEDžtDžp Džl$ hu uGuNx.` `EyD NyߋEEyEXȅ}A)Ru؍EPP裖MԋEEyE؍<}؃t E܉ E1ҋuMB}7}9|䃅hthBH9EMu(JM RPu}IhFP PQuuіEԋVUz} uUE;Eu`EPuu虑|GMЋŰuuPRQ}UEDDtplph;$ lUUDždEЉ8u,E܃8u$1t&d<u<t닍|dDž\+d9}0uЋd1ɋ\E+d9\|ދd)E1E+d9}'u܋d1ɋGE+d9|狵d)ud<t E܋<0t09} E܋ 0duL )9~]WRPP迓Wu؋EPP豓Mԃ UE܉ E|DžX )X9X )V+dRPR詓EH+dEVE+dPU܋PR~ M؉+dE܃|u A+dЉEXVB+dPPW!d)EXRE@+dPEVP U؍J+dE+d|tʉU`(DžTDžP $ LuVu؍EPW1MԋUE܉ EE]}D&LE䉅PJL;A AM9}'Qu܋LFP PPL PQuuyEԃ M؉ȋLBpu}uEUExu)G)ƋE9uM E) DB(EDA )PjQQڐEP9|JPH9ŰJDA9rgE9B[)E䋕PT)y)DžHẺPI8ut&HH<tu?E+H~!}܋HM1‹7Ju}+H}HHu9)9~9GPURQu薏‰UԋuFu؋E܋}Q)9$)Pu+HVt&PuF+HVD Pu葏u؃M䉍P$ 9Lt j uuu軒Eԋ}؉}ME~9}=U~ )PEPQu薎‰Uԃt-E܋MAME~PuVQu}}؀TTE4t&EPu؍EPW/MԋUE܉ EEU R@Dž$Dž DžM A eu!EDž(1}GCfu[EfU 2}}uEH(D8 Dž(G,DžDžM |uDž vDž}u9u} 3v}~*E苵NDž(,GEf}uE@(&Dž(+(,1M A tDž}t"EP(R ,,ȉ0t2,P u<u&" t&,$)ĉ<<84}t }f(9$}?+$$$44$uً($DžU B u}E܃8twE44at&&gfff)E044U ΋U044u N uȅuPt@4+8)@ uj} G0t_@~V}t%@RPMQ4;@@VP}Ww9@Euȅtb}t'UBXP;Pr j--@uF;Fr"j-Vn<-U B @tB}t%MAXP;Prj+H+@rt&uF;Frj++Qt[}t.UBXP;Prj MQBlf @uF;Fr j > }GEE H umU z0ud@~[}t,@Qj0uVW3;@9&@Wj0EP+v9@UDž1҃}}I }u1}эy0t6 ,DPmu, ,DD$)ĉ849sC;Eu QEP ;EuWMQR|B;4r}t +}t u O+~D}GFV}t8PEPBЃ9uv} N8 8}t+}GXP;Pr QWi, @,8EP;PrPUR~kȈ %MAENx{G}t.UBXP;PrQMQKi, @8EP;PrPURjȈ %MAqENu0t!V~EЉEUĉUMMEVUEeEE $E݉UV|DPtw}JЍFEF|DBt$ LHЍr7R|DPu܉ȅt$U:$uBUx}M9sЋu }}t&E)+vpn +n +n Xn +n +n +n Hn +n +n +n hn +n bn +n +n Rn +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n +n Bn M,M@$M t&ME0 M܀MEHMxE tE EEU:*ruJ|DHtmuЍBEB|DBt& LHЍBR|DPu܉ȅt"M9$uPUu9sЋUAM}}uMMAME}_ |DHtMuЍz}B|DBt+& LHЍBR|DPu܉MEEU:.&JMz*ruJ|DHtpuЍBEB|DBt)t& LHЍBR|DPu܅t$u>$uQUȋM9sЋUFu}MMAME}oJ|DHtUuЍz}B|DBt* LHЍBR|DPu܉M&EeeEE.+h␨j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j t&E8htM;@EM/ME8lu@EMe t&MMEUE 8t4,p < tEPjuV ЉEEE؃7+t&'h xh h xh h h h xh xh xh xh xh xh xh xh xh xh xh h xh xh xh xh 8i xh xh xh xh xh xh xh xh h xh h 8i h h h xh 8i xh xh xh xh h 8i h xh xh h xh 8i xh xh 8i Et EEܨt Et EEt EEwEt EhE^&EN&E>&E.&E&E&E}uEt UUE}uEHEE}}JEEƊ}}-EtMQfPV*\~Ft<%uˉu}Et;E s uEt;E s }u;u s@Et9u EU)p U}PE )PEP Ѓu>E;EsEe[^_É'U|WVS[Gg UDžDžE M IDžM A E @ u H @, H( $ 8t $uX Phx P PmM A (۽} <$!XtU B|DBbrtGU B|DBt! !! !m۽(0ݕU$ZtXU B|DBt    Džyt&]tMU B|DBt ! !! !E1U zJ uPtO uD~@tWj URX"Wj MQAe92tgt.UBXP;Prj--@UB;Brj-R:\-U B @tFt!MAXP;Prj+K+@zUB;Brj++]t&t`t3UBXP;Prj MQYh @"t&UB;Br j ; MAt1UBXP;PrQMQEY/v @8EP;PrPURZȈ %MAsNl@t3UBXP;PrQMQX1t& @ 8EP;PrPURTZȈ %MANkE @ tWj UR&Wj MQb9u}E @ qE%11E1 ׉ ЉM yA%PjEPWV( E xA%PjURWV EQL9 v* 009 wEfƅ1uƅ0υu+DžDž~DžtvDžYDžH&u11E1 ׉ ЉM yA%PjEԉU􉕼RWV蟁 M yA%PjPWV胃 E䍵QL9v1&0 09w֋}u(DžDDž@@Dž@)ǃTx0ux0tu)+9<8@9~ED $ȋD|DPu tP uDC|DBut& INv Zt& JU$MuVϰэAPUR+<ǃxtCMA;ArQNxxMAxt|xxuSv}f?| W>}tE,tj$RAE;J1JMAM9t"%PuV^9<ODIMAM%N‹|Dz tDž@ Ixt@uF;FrVMxvxMAxt|xx@|Dp tnvxt?MA;ArQ#MxxMAxt|R8G|xDP uDž@9xHxGxPMQ7GDžpDž<Dž(Dž0M|DQtiЉ(E}DQt#(DBЉ(EEDQu݋U:$t"(tp@Dž(E}MUBU<*t<'t2lu Fup>p5} 3     3     @ 3 H   :  3   3 xt=UB;BrR3GxxuFxt|xxw9AB%8p#BtL(uEMA|1U(H|1tHu0xA&pt<(u EUBU(Ht t&Hu|fApu6(u EUBU(HtHu|KA(uEuFt&U(Ht t&Hu| ApuQ(uEuvP$E(Jt t&JuPPL4t&xt=MA;ArQ3ExxMAxt|xxwtuDžtt&u&xPFPtt5x5}G;GrWDxxMAx5|tt5x5uF;FrV$DxxMAxO5|띐t&puO(uE}L"t&E(Jt t&JuLL9t&xt=uF;FrVsCxxMAxt|xxEE@ǍuxM&WjV1uLPUAxt@UB;BrRBxxE@xt|R}t U t&Mf9| Q3,tj$V5)HTL>xE0uLtts3xf3UB;BrRBxt&xE@x&3|ptt(uEMIH%&E(It t&IuHHe<DžDdjdA3HP<(uEMIP!vE(Jt t&JuPP;t&xt=UB;BrR@xxuFxt|xxGxPFPqHD9PWV